Informatie

Wat betekent 'kinetisch toegankelijk' bij eiwitvouwing?


Het hydrofobe instortingsmodel bespreekt deze term in de sectie energetica. Wat betekent dit eigenlijk?


Op een bepaald moment tijdens eiwitvouwing kunnen er lagere energietoestanden bestaan ​​vanuit een thermodynamisch perspectief (lagere ΔG vrije energie) die eigenlijk onbereikbaar zijn in een bepaalde omgeving, omdat de vereiste activeringsenergie te hoog is. Dit zijn kinetisch ontoegankelijke toestanden, omgekeerd toegankelijke toestanden zijn die welke kunnen worden bereikt.

Dat zou bijvoorbeeld kunnen betekenen dat een eiwit een lagere energietoestand kan bereiken door een beetje te ontvouwen, maar het zelfs tijdelijk blootstellen van hydrofoob aminozuur zou te veel energie vergen. Dus de lagere energietoestand is niet kinetisch toegankelijk.

Dit is enigszins vergelijkbaar met het concept van kinetische en thermodynamische reactieproducten in de chemie.


Een eiwitsequentie die de oorspronkelijke structuur kan coderen door alternatieve conformaties af te keuren

De lineaire volgorde van aminozuren bevat alle noodzakelijke informatie om een ​​eiwit te laten vouwen in zijn unieke driedimensionale structuur. Van natuurlijke eiwitsequenties is bekend dat ze dit bereiken door de vorming van stabiele, kinetisch toegankelijke structuren te bevorderen. Hier beschrijven we een Pro-residu in het midden van de derde transmembraanhelix van de transmembraangeleidingsregulator van cystische fibrose die het vouwen bevordert door een duidelijk mechanisme: de vorming van een verkeerd gevouwen structuur afkeurend. De algemeenheid van dit mechanisme wordt ondersteund door genoombrede transmembraansequentieanalyses. Bovendien bieden de resultaten een verklaring voor de verhoogde frequentie van Pro-residuen in transmembraan--helices. Het van nature opnemen van dergelijke 'negatieve vouwdeterminanten', gericht op het voorkomen van de vorming van off-pathway-structuren, vertegenwoordigt een extra mechanisme waarmee vouwinformatie wordt gecodeerd in de geëvolueerde sequenties van eiwitten.


We voeren Monte Carlo-simulaties uit van het all-atom-model van CI2. De all-atom Monte Carlo is elders uitvoerig beschreven (7). We identificeren onze vermeende TSE met behulp van de methode van Vendruscolo et al. (5). In onze simulaties benaderen we de experimenteel bepaalde φ-waarden van aminozuren ψm door de verhouding van het aantal contacten dat elk aminozuur in de TSE maakt, N ‡ , naar die in de oorspronkelijke staat van CI2, N NS , 1 Om de vermeende TSE te genereren, voeren we ontvouwende simulaties uit van de oorspronkelijke structuur van CI2 op t = 2,3 door gebruik te maken van de vorm van de potentiële energie van aminozuurinteracties 2 waarbij EGaan is de Gō potentiële energie (20-22), waarbij het aantrekkelijke potentieel (EGaan = −1) tussen residuen wordt toegewezen aan de paren die in de oorspronkelijke staat met elkaar in contact zijn, en de afstotende potentiaal (EGaan = +1) wordt toegewezen aan de paren die in de oorspronkelijke staat geen contact hebben. De parameter Λ = 103 is ingesteld op een hoge waarde vergeleken met de Gō-potentiaal om de omgeving van elk aminozuur te versterken, k, in onze simulaties dicht in de buurt komen van die experimenteel waargenomen. deexp zijn de experimentele φ-waarden bij 0 M GdHCl van Itzhaki et al. (8) voor de volgende 39 mutaties: K2M, T3A, P6A, E7A, L8A, S12A, E14N, E15Q, A16G, K17A, K18G, I20V, L21A, Q22G, K24G, P25A, E26A, I29A, I30A, L32A, V34T , T36V, V38A, T39A, E41A, Y42G, R43G, D45A, V47A, L49A, F50A, V51A, D52A, N56D, I57A, A58G, V60G, P61A en V63A. ψm voor I57A is ingesteld op 0,5, omdat dit residu ondanks zijn lage φ-waarde deel uitmaakt van de kern (23). De som is over de N = 39 posities hierboven vermeld.

Voor elke vermeende TSE-conformatie (40 in totaal) berekenen we de kans om naar zijn oorspronkelijke staat te vouwen door 20 onafhankelijke simulaties uit te voeren op t = 1,2 voor 5 × 107 Monte Carlo-stappen, wat minder is dan 5% van de vouwtijd van een willekeurige spoel (gegevens niet getoond ref. 24). We beschouwen het systeem als gevouwen wanneer de RMSD voor de ruggengraat van het eiwit kleiner is dan 1Å. De gemiddelde kans op vouwen PVOUW is 0,59, wat bevestigt dat de geselecteerde conformaties tot de TSE behoren. In Tabel 1 presenteren we de gegevens voor de 20 conformaties met PVOUW ≥ 0,8, die toestanden na de overgang vertegenwoordigen.

We construeren de pretransitie conformaties op een gelijkaardige manier als de vermeende TSE conformaties behalve dat de φexp waarden zijn kunstmatig ingesteld en zijn niet overgenomen uit experimenten (24). Wij kiezenexp om structuren te creëren met ongeveer dezelfde energie en RMSD als de TSE-conformaties (tabel 1). Voor de constructie van de pretransitie conformaties kiezen we de φexp 0,5 voor K2, E4, E7, L8, K11, E15, K18, V19 en D23 en 0,4 voor V60, P61, R62 en V63. Om pretransitie conformaties te creëren die van elkaar verschillen, wisselen we de φexp waarden tussen deze conformaties. In Tabel 1 presenteren we de gegevens voor de zes conformaties met PVOUW ≈ 0, die pre-overgangstoestanden vertegenwoordigen.

C-Src SH3-domein.

We modelleren het C-Src SH3-domein door kralen die C . vertegenwoordigenα en Cβ atomen. Om de flexibiliteit van echte eiwitten na te bootsen, passen we extra beperkingen toe (F.D., N.V.D., S. Buldyrev, H.E. Stanley en E.I.S., niet-gepubliceerde gegevens): (l) "covalente" bindingen tussen Ci en Ci, (ii) "peptide"-bindingen tussen Ci en Cα(i±1), (iii) effectieve bindingen tussen Ci en Cα(i±1), (NS) effectieve bindingen tussen Ci en Cα(i±2), waar het subscript l geeft het aminozuurvolgnummer aan. We gebruiken de Gō-potentiaal (20-22) om interacties tussen C . te modellerenβ atomen van het C-Src SH3-domein. Er is aangetoond (F.D., N.V.D., S. Buldyrev, H.E. Stanley en E.I.S., niet-gepubliceerde gegevens) dat ons model van het C-Src SH3-domein de thermodynamische en kinetische eigenschappen die in experimenten zijn waargenomen, getrouw kan reproduceren (9, 10).

Om de TSE en vervolgens de toestanden voor en na de overgang te identificeren, volgen we de methode die is ontwikkeld in ref. 32 (F.D., N.V.D., S. Buldyrev, H.E. Stanley en E.I.S., niet-gepubliceerde gegevens). We voeren de discrete moleculaire dynamica-simulatie van het C-Src SH3-domein uit bij de vouwovergangstemperatuur, tF € 0,92. We selecteren conformaties die behoren tot de vermeende TSE uit die met de potentiële energie in het bereik <ETS>, overeenkomend met het minimum van de waarschijnlijkheid van het potentiële energiehistogram bij t = tF (figuur 1a in ref. 4). We onderscheiden vier soorten fluctuaties tijdens de simulatie van het C-Src SH3-domein die door de onstabiele toestanden gaan binnen energieën in het bereik <ETS>: (l) FF, wanneer het gevouwen eiwit zich ontvouwt tot <ETS> en vouwt zich dan snel weer in zijn oorspronkelijke staat, (ii) UU, wanneer het ongevouwen eiwit gedeeltelijk vouwt in <ETS> en ontvouwt zich dan snel, (iii) FU, wanneer het gevouwen eiwit zich ontvouwt tot <ETS>, en gaat dan verder met ontvouwen, en (NS) UF, wanneer het ongevouwen eiwit het energiebereik doorloopt <ETS> op weg naar gevouwen conformaties.

Vervolgens berekenen we PVOUW voor elke geselecteerde conformatie door 10 2 onafhankelijke simulaties uit te voeren voor 2 × 10 3 tijdseenheden bij tF. De gemiddelde tijd dat het C-Src SH3-domein in de uitgevouwen toestand doorbrengt, is 105 tijdseenheden, terwijl de gemiddelde en maximale tijd van het vouwen van het C-Src SH3-domein vanuit een uitgevouwen toestand waarbij het C-Src SH3-domein al is vastgelegd voor het opvouwen overgang is dienovereenkomstig 10 2 en 10 3 tijdseenheden.

We vinden dat de PVOUW van de meest representatieve UF- en FU-conformaties is ≈0,5, wat suggereert dat deze conformaties tot de TSE behoren. Voor UU- en FF-conformaties vinden we dat de PVOUW waarden zijn respectievelijk ≈0 en ≈1. We selecteren dus de pre- en posttransitie conformaties uit de UU- en FF-ensembles van conformaties dienovereenkomstig.

De eiwitgrafieken.

De eiwitgrafieken zijn opgebouwd op basis van de Cα voorstelling van eiwitten. Elke grafiekknoop vertegenwoordigt een aminozuur. Elke grafiekrand verbindt paren knooppunten die overeenkomen met paren aminozuren die zich geometrisch binnen een interactiedrempelradius bevinden, die we hebben ingesteld op RC = 8,5 . We testen grafiekconnectiviteitseigenschappen voor verschillende definities van contacten en ontdekken dat deze eigenschappen kwalitatief invariant zijn onder contactdefinities.

De gemiddelde minimale afstand L(k), ook gekend als de chemische afstand (25), tussen een knoop k en de rest van de grafiekknooppunten is gedefinieerd als 3 waarbij N is het aantal knopen in de grafiek of het aantal aminozuren in eiwitten, ℓkj is het minimale aantal randen dat men moet transverseren om een ​​knoop te bereiken J van een knoop kJ. Het middelen wordt gedaan over alle toestanden vóór of na de overgang. Analoog definiëren we de gemiddelde minimale afstand L tussen alle knopenparen van de eiwitgrafiek 4 Bijvoorbeeld de minimale afstand tussen de knopen N1 en V20 in de grafiek van Fig. 1C is 3, het pad dat overeenkomt met de minimale afstand loopt door de knooppunten E5 en P7: N1 → E5 → P7 → V20.


Discussie

GroEL en GroES functioneren niet als passieve vouwdoos

Er zijn verschillende mechanismen voorgesteld om uit te leggen hoe GroEL eiwitvouwing vergemakkelijkt. We hebben aangetoond dat GroEL functioneert als een moleculaire chaperonne, althans gedeeltelijk, door de actieve herschikking van eiwitconformatietoestanden. Daarentegen stellen puur passieve modellen van GroEL-actie, bijvoorbeeld het Anfinsen-kooimodel (Ellis, 1994), de essentiële rol van GroEL voor als het eenvoudigweg onderdrukken van niet-productieve eiwitaggregatie. Hier hebben we echter aangetoond dat een kinetische val die het vouwen van RuBisCO blokkeert, het gevolg is van stabiel, intrachain verkeerd vouwen en niet van aggregatie. Het is veelbetekenend dat deze verkeerd gevouwen maar monomere RuBisCO niet spontaan kan vouwen in de loop van enkele uren, hoewel GroEL en GroES onder dezelfde omstandigheden hervouwen kunnen aansturen met een halfwaardetijd van ongeveer 20 minuten. Deze waarnemingen tonen aan dat GroEL-gemedieerde hervouwing van het kinetisch opgesloten RuBisCO niet te wijten kan zijn aan eenvoudige, passieve remming van aggregatie.

De corrigerende actie van GroEL vindt plaats op twee niveaus. Ten eerste wordt de grove structuur van het niet-native RuBisCO-tussenproduct herschikt bij binding aan een GroEL-ring. Vervolgens veroorzaakt binding van ATP en GroES aan een door RuBisCO bezette GroEL-ring een dramatische verdichting van het vouwende tussenproduct omdat het wordt verzegeld in de bijgevoegde GroEL-GroES-ATP cis complex. Deze waarnemingen ondersteunen en verenigen twee actieve modellen van GroEL-gemedieerde vouwing: (1) substraatontvouwing en (2) conformationele restrictie.

Het ontvouwen van substraatproteïnen door GroEL

Hoewel mechanistisch controversieel, is het ontvouwen van substraateiwitten door GroEL eerder waargenomen. Er is gesuggereerd dat het ontvouwen van een doeleiwit door GroEL plaatsvindt door twee mechanismen: (1) door binding geïnduceerde ontvouwing en (2) geforceerde ontvouwing. Door binding geïnduceerde ontvouwing is waargenomen met verschillende niet-stringente GroEL-substraateiwitten (Bhutani en Udgaonkar, 2000 Clark en Frieden, 1999 Gervasoni et al., 1998 Walter et al., 1996 Zahn et al., 1994, 1996 Zahn en Pluckthun, 1994) . Over het algemeen lijkt GroEL in staat om uitgebreide ontvouwing van veel eiwitten te stimuleren door de selectie en stabiele binding van minder gevouwen conformationele toestanden. Er is daarentegen gesuggereerd dat geforceerd ontvouwen optreedt bij de vorming van de GroEL-ES cis holte. In wezen wordt aangenomen dat een mechanische ontvouwingskracht de structuur van een gebonden substraateiwit verstoort wanneer de apicale domeinen van GroEL herschikken om de binding van GroES te accommoderen (Shtilerman et al., 1999). Hoewel tritiumuitwisselingsstudies met RuBisCO consistent waren met dit idee (Shtilerman et al., 1999), vonden vergelijkbare experimenten met MDH geen bewijs voor gedwongen ontvouwing op cis complexvorming (Chen et al., 2001). Wat nog belangrijker is, is dat uitgebreide ontvouwing van strikt afhankelijke GroEL-substraten niet is aangetoond. Verschillende onderzoeken hebben inderdaad weinig bewijs gevonden van globale structurele destabilisatie van verschillende eiwitten na binding aan GroEL (Chen et al., 2001 Goldberg et al., 1997 Gross et al., 1996 Robinson et al., 1994). Deze uiteenlopende waarnemingen hebben de vraag opengelaten of het ontvouwen van het substraat een significante, mechanistische rol speelt bij GroEL-gemedieerde vouwing.

Onze demonstratie dat het vouwen van RuBisCO een herschikking van een kinetisch opgesloten vouwintermediair inhoudt, suggereert sterk dat het ontvouwen van het substraat door GroEL van centraal belang kan zijn bij het gefaciliteerd vouwen van eiwitten. De gegevens die in de huidige studie worden gepresenteerd, bieden echter geen bewijs voor gedwongen ontplooiing. We detecteren geen dramatische uitrekking van het RuBisCO-monomeer bij cis complexe vorming. We constateren juist het tegenovergestelde. In plaats van een geforceerde expansie van RuBisCO na GroES-binding, zien we een dramatische compressie van de RuBisCO-structuur. Hoewel deze waarnemingen niet consistent zijn met geforceerd ontvouwen, kunnen de enkele, gemiddelde afstandsmetingen die in het huidige onderzoek zijn gedaan, de mogelijkheid niet uitsluiten dat enige ontvouwing gepaard gaat met de verdichting van de RuBisCO-structuur bij GroES-binding. Eerdere experimenten die de fluorescentie-anisotropie van de RuBisCO-tryptofaanresiduen volgden, toonden inderdaad aan dat cis complexvorming induceert significante interne veranderingen in de gebonden RuBisCO-structuur (Rye et al., 1997).

De expansie en ontvouwing die we hebben waargenomen, lijkt op te treden tijdens en na binding van het RuBisCO-monomeer aan een open GroEL-ring. De maximale ontvouwing die GroEL aan RuBisCO kan leveren, lijkt echter niet nodig te zijn voor volledig productief vouwen. Hoewel uitgebreide modificatie van het RuBisCO-tussenproduct kan plaatsvinden op een open GroEL-ring tijdens een typische reactiecyclus (10� s), is de maximale herschikking die we waarnemen te langzaam (� min) om verplicht te zijn (Figuur 5). Bovendien, ondanks het feit dat SR1 niet zo'n grote structurele verstoring veroorzaakt als wildtype GroEL (Figuur 5), zijn zowel GroEL als SR1 even efficiënt in het vouwen van RuBisCO (Rye et al., 1997). Het blijft daarom onduidelijk hoeveel ontvouwen nodig is om productief vouwen te activeren. Opmerkelijk is dat door binding geïnduceerde ontvouwing voldoende conformationele modificatie kan bieden om enige productieve vouwing van RuBisCO te laten plaatsvinden na vrijgave uit de trans ring (Farr et al., 2003). Dit trans-ringvouwmodus is aanzienlijk minder efficiënt bij het vouwen van RuBisCO dan GroEL-geassisteerd vouwen waarbij GroES-inkapseling betrokken is. Bovendien is het vouwen van RuBisCO maximaal productief met SR1 na slechts een enkele ronde van door binding geïnduceerde ontvouwing, op voorwaarde dat het tussenproduct binnen het ingesloten SR1-GroES-complex wordt gehouden (Rye et al., 1997). Deze waarnemingen suggereren dat, naast het ontvouwen, de inkapseling van een vouwend tussenproduct in de cis complex is een essentieel aanvullend ondersteuningsniveau van GroEL en GroES.

Opsluiting en verdichting van substraateiwit

Twee eenvoudige mechanismen kunnen de snelle compressie van het aan GroEL gebonden RuBisCO-tussenproduct verklaren cis complexe vorming. Verdichting kan het gevolg zijn van ofwel (1) interne ineenstorting van het geëxpandeerde opvouwbare tussenstuk op cis complexvorming en afgifte in de holte, of (2) een gerichte, samendrukkende actie geleverd aan het geëxpandeerde vouwtussenproduct wanneer het in de holte wordt gestopt cis holte bij GroES-binding. Op het niveau van onze huidige analyse kunnen we geen onderscheid maken tussen deze mechanismen. De verdichting die we waarnemen, kan een voorbijgaande, samendrukkende impuls zijn die rechtstreeks aan het gebonden eiwit wordt afgegeven en die nodig is om extra structurele verandering in het vouwintermediair te induceren en dus vouwing te activeren. Als alternatief, als de verdichting die we waarnemen het gevolg is van relaxatie van het uitgerekte vouwende tussenproduct bij het loslaten in de cis holte, is het opvallend dat de gemiddelde afstand tussen N- en C-terminale domeinen in de eerste paar seconden na release (� Å) meetbaar verschilt van de gemiddelde afstand tussen deze domeinen in de kinetisch opgesloten toestand (� Å) x0223c37 Å). Deze observatie suggereert sterk dat opsluiting binnen de cis complex blokkeert expliciet de populatie van tussenliggende toestanden van het RuBisCO-monomeer die kinetisch niet-productief zijn in een vrije oplossing.

Onze waarnemingen ondersteunen dus een actieve rol voor GroEL bij het vouwen van eiwitten die verder gaat dan het eenvoudig ontvouwen van verkeerd gevouwen tussenliggende toestanden. In wezen lijkt GroEL de conformationele ruimte die beschikbaar is voor een vouweiwit te bewerken door het te comprimeren en te beperken in de ruimtelijk vernauwde GroEL-GroES-holte. Verschillende aanvullende waarnemingen ondersteunen ook een dergelijk model van GroEL-actie. Een recente studie wees uit dat inkapseling van het RuBisCO-monomeer in de GroEL-GroES-holte het vouwen versnelt tot voorbij de snelheid die haalbaar is in vrije oplossing onder permissieve omstandigheden (Brinker et al., 2001). Er werd gesuggereerd dat opsluiting van het RuBisCO-vouwtussenproduct binnen de cis complex zou daarom het vouwlandschap van een eiwit kunnen wijzigen en productieve vouwing kunnen stimuleren. Verschillende theoretische behandelingen hebben dit idee ondersteund (Baumketner et al., 2003 Takagi et al., 2003). Er zou echter worden voorspeld dat het stimulerende effect van opsluiting alleen significant zal blijven als een vouwend tussenproduct in de GroEL-GroES-holte wordt gehandhaafd. Bij vrijgave zou die subset van moleculen die een toegewijde toestand hebben bereikt, verder gaan met vouwen, terwijl degenen die terugvallen in kinetisch opgesloten toestanden zouden moeten worden heroverd, ontvouwd en verdicht.

Samenvattend lijkt het vouwmechanisme dat door GroEL wordt gebruikt om productief vouwen te stimuleren op drie niveaus te werken (Figuur 7). Ten eerste dient de binding van GroEL aan aggregatiegevoelige vouwintermediairen om de progressie van onomkeerbare aggregatie direct te stoppen, met name bij de eiwitconcentraties die aanwezig zijn in een levende cel. Ten tweede is de hydrofobe, multivalente GroEL-ring direct in staat tot significante structurele herschikking van de vouwende tussenproducten die hij vangt. Efficiënte vouwing van eiwitten zoals RuBisCO vereist echter verder de binding van GroES over de bovenkant van een gevangen vouwend tussenproduct, wat resulteert in de verdichting van het vouwende tussenproduct bij de vorming van de cis holte. Hoewel de mate waarin compressie en opsluiting werken op verschillende substraateiwitten niet helemaal duidelijk is, lijkt het zeker dat opsluiting belangrijk is voor sommige stringente GroEL-substraten. Gegradeerde niveaus van assistentie bij GroEL-gemedieerde vouwing zouden deze chaperonne-machine in staat kunnen stellen om effectief te werken aan verschillende eiwitten met een verscheidenheid aan vereisten.

Denaturatie van een RuBisCO-dimeer resulteert in de vorming van een verkeerd gevouwen, kinetisch gevangen monomeer. Het verkeerd gevouwen monomeer is zeer vatbaar voor aggregatie, wat in de vroege stadia omkeerbaar is. Binding van GroEL aan het aggregatiegevoelige monomeer kan de voortgang van aggregatie blokkeren. Volledig productieve hervouwing van RuBisCO vereist twee extra stadia van gerichte structurele modificatie van het verkeerd gevouwen monomeer. Ten eerste resulteert binding van het RuBisCO-monomeer aan een GroEL-ring in uitbreiding of rek van de afstand tussen de N- en C-terminale domeinen. Aanvullende conformationele wijziging van het RuBisCO-tussenproduct, gepaard gaande met de waargenomen N-naar-C-terminale expansie, is waarschijnlijk. Daaropvolgende inkapseling van het RuBisCO-monomeer na binding van ATP en GroES resulteert in een verdichting van het vouwende tussenproduct in de GroEL-GroES-holte.


Materialen en methodes

Gp41 Constructen en Sequenties.

Behalve in het construct dat het verlengde 6HB (gp41-ll-ext) bevat, bevatten alle gp41-monomeren 40-aa NHR's en 38-aa CHR's die overeenkomen met gp160-aminozuren 543� en 625�, respectievelijk. De NHR's en CHR's waren verbonden door 5-aa flexibele afstandhouders (Gly/Ser) zoals eerder ontworpen (31) behalve de gp41-haarspeld die onderzocht moest worden (Fig. 1 NS en E ), die ofwel een 5-aa korte linker (sl) of een 19-aa lange linker (ll) bevat die overeenkomt met respectievelijk gp160 aminozuren 597� en 583�. De verschillende gp41-monomeren werden verbonden door 6-aa flexibele afstandhouders. Het natuurlijke cysteïne in het lusgebied werd gemuteerd tot serine. Een N-terminale spacer die een cysteïneresidu (CGGSGGSKGGSNG) bevat en een C-terminale spacer die een Flag-tag en een Avi-tag bevat (GGNSG DYKDDDDK GSGGSGNGGSGDSLEFIASKLAG GLNDIFEAQKIEWHE) werden toegevoegd aan de tandemherhalingssequenties van gp41-monomeren. Het gp41-ll-hp2-construct is vergelijkbaar met gp41-ll, behalve dat de tweede en de derde haarspeld waren verbonden door de flexibele afstandsreeks GSGNSKSAGSGGSGSVSPSNKLKSSDAYGSKKAWGNNQDGVVASQSGANSGGLKGGQSSG en de NHR en CHR van de derde haarspeld die in de derde haarspeld waren verbonden door de afstandshouder GGGGNSGWHKGGGGDDGSKGSGSSKWHKGGDDDDGSGSIASGASKWH de splitsingsplaats van het Tobacco Etch Virus (TEV) is onderstreept. Het gp41-ll-ext construct is identiek aan gp41-ll, behalve dat de FPPR (aminozuren 528�) de MPER (aminozuren 663�) werden toegevoegd aan de N-terminus van NHR en de C-terminus van CHR (10 ), respectievelijk ( Afb. 1EEN ).

Genen die overeenkomen met deze gp41-constructen werden codon-geoptimaliseerd, gesynthetiseerd, gesubkloneerd in de eiwitexpressievector pET-SUMO en geïnduceerd tot expressie in BL21 (DE3) E coli cellen gebruikmakend van isopropyl β-d-1-thiogalactopyranoside zoals eerder beschreven (27). De eiwitten werden gezuiverd met behulp van Ni-NTA-hars (GE Healthcare Biosciences) en gebiotinyleerd met behulp van biotine-ligase (Avidity). Het gp41-ll-hp2-eiwit werd gedurende meer dan 2 uur bij kamertemperatuur gesplitst door TEV-protease vóór verdere zuivering om het protease te verwijderen.

Dual-Trap optische pincet met hoge resolutie.

Het pincet was zelfgemaakt zoals eerder beschreven (48, 49, 54). De machine werd op afstand bediend met behulp van een LabVIEW (National Instruments) interface. De kracht en verplaatsing werden gekalibreerd door Brownse beweging van de gevangen polystyreenkorrels vóór elk experiment met één molecuul.

Single-Molecule Protein Folding Experiment.

Het gp41-eiwit werd gereduceerd met Tris-(2-carboxyethyl)fosfine, gemengd met het thiolbevattende DNA-handvat behandeld met dithiodipyridine in een typische 50:1 eiwit:DNA molaire verhouding, en gedurende de nacht verknoopt met het DNA-handvat. Een aliquot van het eiwit-DNA-conjugaat werd gemengd met met anti-digoxigenine beklede korrels en geïnjecteerd in het microfluïdische kanaal (49). Eén DNA-gebonden kraal werd gevangen door één optische val, dicht bij een met streptavidine gecoate kraal gebracht die in de andere optische val werd gehouden, vormde een enkele gp41-DNA-ketting en werd getrokken met een optisch pincet. Het vouwexperiment met één molecuul werd uitgevoerd bij kamertemperatuur (22 ° C) in PBS aangevuld met een zuurstofopvangsysteem. Bovendien werd zoals aangegeven 4 mM DPC, 0,5% Triton X-100 en/of T20 aan de PBS-buffer toegevoegd.

Gegevensanalyse.

Methoden voor data-analyse worden elders in detail beschreven (27, 38). Een nieuw algoritme wordt gebruikt voor de drie-toestanden HMM van de gp41-overgang in aanwezigheid van T20. Het algoritme maximaliseert de waarschijnlijkheidsfunctie op basis van de gradiëntafdalingsmethode (55) met beperkingen voor gedetailleerde balans.


Kinetiek versus thermodynamica bij het vouwen van eiwitten

Artikelweergaven zijn de COUNTER-conforme som van full-text artikeldownloads sinds november 2008 (zowel PDF als HTML) bij alle instellingen en individuen. Deze statistieken worden regelmatig bijgewerkt om het gebruik in de aanloop naar de afgelopen dagen weer te geven.

Citaties zijn het aantal andere artikelen waarin dit artikel wordt geciteerd, berekend door Crossref en dagelijks bijgewerkt. Vind meer informatie over Crossref citatietellingen.

De Altmetric Attention Score is een kwantitatieve maat voor de aandacht die een onderzoeksartikel online heeft gekregen. Als u op het donutpictogram klikt, wordt een pagina op altmetric.com geladen met aanvullende details over de score en de aanwezigheid op sociale media voor het betreffende artikel. Vind meer informatie over de Altmetric Attention Score en hoe de score wordt berekend.

Opmerking: In plaats van een samenvatting is dit de eerste pagina van het artikel.


Referenties

Levinthal, C. in Mossbauer-spectroscopie in biologische systemen (red. Monticello, I.L., Debrunner, P., Tsibris, J.C.M. & Munck, E.) 22-24 (Univer. of Illinois Press, Urbana, Illinois, 1969).

Tramontano, A. Van mannen en machines. Natuur structuur. Biol. 10, 87–90 (2003).

Fersht, A.R. & Daggett, V. Eiwit vouwen en ontvouwen met atomaire resolutie. Cel 108, 573–582 (2002).

Matouschek, A. Eiwitontplooiing - een belangrijk proces in vivo? Curr. Opin. structuur Biol. 13, 98–109 (2003).

Dobson, C. M. Eiwitmisvouwingsziekten: uit vorm raken. Natuur 418, 729–730 (2002).

Kelly, J.W. Op weg naar een goed begrip van amyloïdogenese. Natuur structuur. Biol. 9, 323–325 ( 2002).

Kim, P. S. & Baldwin, R. L. Specifieke tussenproducten in de vouwreacties van kleine eiwitten en het mechanisme van eiwitvouwing. Ann. ds. Biochem. 51, 459–489 (1982).

Karplus, M. & Weaver, D. L. Dynamiek van eiwitvouwing. Natuur 260, 404–406 (1976).

Wetlaufer, D. B. Nucleatie, snelle vouwing en bolvormige intraketengebieden in eiwitten. Proc. Natl Acad. Wetenschap. VS 70, 697–701 (1973).

Ptitsyn, O. B. Eiwitvouwing: hypothesen en experimenten. J. prot. Chem. 6, 273–293 (1987).

Daggett, V. & Fersht, A.R. Is er een verenigend mechanisme voor het vouwen van eiwitten. TrendsBiochem. Wetenschap. 28, 19–26 (2003).

Fersht, A.R. et al. Het vouwen van een enzym I. Theorie van eiwitengineeringanalyse van stabiliteit en route van eiwitvouwing. J. Mol. Biol. 224, 771–782 (1992).

Li, A. & Daggett, V. Karakterisering van de overgangstoestand van het ontvouwen van eiwitten door gebruik te maken van moleculaire dynamica: chymotrypsine-remmer 2. Proc. Natl Acad. Wetenschap. VS 91, 10430–10434 (1994).

Lazaridis, T. & Karplus, M. 'Nieuwe kijk' op eiwitvouwing verzoend met het oude door meerdere ontvouwingssimulaties. Wetenschap 278, 1928–1931 (1997).

Dag, R. et al. Het verhogen van de temperatuur versnelt het ontvouwen van eiwitten zonder het ontvouwen te veranderen. J. Mol. Biol. 322, 189–203 (2002).

Bennion, B. & Daggett, V. De moleculaire basis voor de chemische denaturatie van eiwitten door ureum. Proc. Natl Acad. Wetenschap. VS 100, 5142–5147 (2003).

Kazmirski, S.L. et al. Eiwitvouwing vanuit een zeer ongeordende gedenatureerde toestand: de vouwroute van chymotrypsine-remmer 2 bij atomaire resolutie. Proc. Natl Acad. Wetenschap. VS 98, 4349–4354 (2001).

Wong, K.B. et al. Op weg naar een volledige beschrijving van de structurele en dynamische eigenschappen van de gedenatureerde staat van barnase en de rol van de reststructuur bij het vouwen. J. Mol. Biol. 296, 1257–1282 (2002).

Bond, C.J. et al. Karakterisering van de reststructuur in de thermisch gedenatureerde toestand van barnase door simulatie en experiment: beschrijving van de vouwroute. Proc. Natl Acad. Wetenschap. VS 94, 13409–13413 (1997).

Li, A. & Daggett, V. De ontvouwing van barnase: karakterisering van het belangrijkste tussenproduct. J. Mol. Biol. 275, 677–694 (1998).

Daggett, V., Li, A. & Fersht, A.R. Een gecombineerde moleculaire dynamica en Φ-waarde-analyse van structuur-reactiviteitsrelaties in de overgangstoestand en ontvouwende route van barnase: de structurele basis van hammond- en anti-hammondeffecten. J. Ben. Chem. Soc. 120, 12740–12754 (1998).

Burgemeester, U. et al. De volledige vouwroute van een eiwit van nanoseconden tot microseconden. Natuur 421, 863–867 (2003).

Kazmirski, S. L. & Daggett, V. Simulaties van de structurele en dynamische eigenschappen van gedenatureerde eiwitten: de 'gesmolten spoel'-toestand van runderpancreatische trypsineremmer. J. Mol. Biol. 277, 487–506 (1998).

Dobson, C. M. Ongevouwen eiwitten, compacte toestanden en gesmolten bolletjes. Curr. Opin. structuur Biol. 2, 6–12 (1992).

Blanco, F.J., Serrano, L. & Forman-Kay, J.D. Hoge populaties van niet-inheemse structuren in de gedenatureerde staat zijn compatibel met de vorming van de inheemse gevouwen staat. J. Mol. Biol. 284, 1153–1164 (1998).

Baldwin, R. Een nieuw perspectief op ongevouwen eiwitten. Adv. prot. Chem. 62, 361–367 (2002).

Shortle, D. De uitgebreide gedenatureerde toestand: een ensemble van conformaties gevangen in een lokaal gecodeerde topologische ruimte. Adv. prot. Chem. 62, 1–23 (2002).

Smith, C.R., Mateljevic, N. & Bowler, B.E. Effecten van topologie en uitgesloten volume op conformationele eigenschappen van gedenatureerde toestand van eiwitten. Biochemie 41, 10173–10181 (2002).

Krantz, B.A. et al. Snelle en langzame tussentijdse accumulatie en het initiële barrièremechanisme bij eiwitvouwing. J. Mol. Biol. 324, 359–371 (2002).

Sanchez, I.E. & Kiefhaber, T. Bewijs voor sequentiële barrières en verplichte tussenproducten bij schijnbare eiwitvouwing in twee toestanden. J. Mol. Biol. 325, 367–376 (2003).

Daggett, V. et al. Structuur van de overgangstoestand voor het vouwen van een eiwit afgeleid van experiment en simulatie. J. Mol. Biol. 257, 430–440 (1996).

Paci, E., Vendruscolo, M., Dobson, C. M. & Karplus, M. Bepaling van een overgangstoestand bij atomaire resolutie van eiwittechnische gegevens. J. Mol. Biol. 324, 151–163 (2002).

Paci, E., Clarke, J., Steward, A., Vendruscolo, M. & Karplus, M. Zelfconsistente bepaling van de overgangstoestand voor eiwitvouwing: toepassing op een fibronectine type III-domein. Proc. Natl Acad. Wetenschap. VS 100, 394–399 (2003).

Makarov, D.E., Keller, C.A., Plaxco, K.W. & Metiu, H. Hoe de vouwsnelheidsconstante van eenvoudige eiwitten met één domein afhangt van het aantal native contacten. Proc. Natl Acad. Wetenschap. VS 99, 3535–3539 (2002).

Fersht, A.R. Overgangstoestandstructuur als een verenigende basis in eiwitvouwmechanismen: contactvolgorde, ketentopologie, stabiliteit en het uitgebreide kernmechanisme. Proc. Natl Acad. Wetenschap. VS 97, 1525–1529 (2000).

Grantcharova, V.P., Riddle, D.S. & Baker, D. Langeafstandsvolgorde in de src SH3-vouwovergangstoestand. Proc. Natl Acad. Wetenschap. VS 97, 7084–7089 (2000).

Garcia, P., Serrano, L., Durand, D., Rico, M. & Bruix, M. NMR en SAXS karakterisering van de gedenatureerde toestand van het chemotactische eiwit CheY: implicaties voor de initiatie van eiwitvouwing. Eiwit Sc. 10, 1100–1112 (2001).

Hollien, J. & Marqusee, S. Vergelijking van de vouwprocessen van T. thermophilus en E coli ribonucleasen H. J. Mol. Biol. 316, 327–340 (2002).

Kortemme, T., Kelly, M.J.S., Kay, L.E., Forman-Kay, J. & Serrano, L. Overeenkomsten tussen de gedenatureerde toestand van het spectrine SH3-domein en de opvouwbare overgangstoestand. J. Mol. Biol. 297, 1217–1229 (2000).

Teilum, K., Maki, K., Kragelund, B.B., Poulsen, F.M. & Roder, H. Vroeg kinetisch tussenproduct in de vouwing van acyl-CoA-bindend eiwit gedetecteerd door fluorescentielabeling en ultrasnel mengen. Proc. Natl Acad. Wetenschap. VS 99, 9807–9812 (2002).

Duan, Y. & Kollman, P. A. Paden naar een eiwitvouwingstussenproduct waargenomen in een simulatie van 1 microseconde in een waterige oplossing. Wetenschap 282, 740–744 (1998).

Snow, C.D., Nguyen, H., Pande, V.S. & Gruebele, M. Absolute vergelijking van gesimuleerde en experimentele dynamiek van eiwitvouwing. Natuur 420, 102–106 (2002).

Fersht, A.R. Over de simulatie van eiwitvouwing door moleculaire dynamica op korte tijdschaal en gedistribueerd computergebruik. Proc. Natl Acad. Wetenschap. VS 99, 14122–14125 (2002).

Carrion-Vazquez, M. et al. Mechanische en chemische ontvouwing van een enkel eiwit: een vergelijking. Proc. Natl Acad. Wetenschap. VS 96, 3694–3699 (1999).

Lu, H. & Schulten, K. De belangrijkste gebeurtenis in de door kracht geïnduceerde ontvouwing van de immunoglobuline-domeinen van titine. Biofysica. J. 79, 51–65 (2000).

Paci, E. & Karplus, M. Ontvouwen van eiwitten door externe krachten en temperatuur: het belang van topologie en energie. Proc. Natl Acad. Wetenschap. VS 97, 6521–6524 (2000).

Fowler, S. B. & Clarke, J. In kaart brengen van de vouwroute van een immunoglobulinedomein: structureel detail van phi-waardeanalyse en beweging van de overgangstoestand. Structuur 9, 355–366 (2001).

Brockwell, D.J. et al. Het effect van kerndestabilisatie op de mechanische weerstand van I27. Biofysica. J. 83, 458–472 (2002).

Fowler, S.B. et al. Mechanische ontvouwing van een titine-Ig-domein: structuur van ontvouwend tussenproduct onthuld door AFM, moleculaire dynamische simulaties, NMR en eiwittechnologie te combineren. J. Mol. Biol. 322, 841–849 (2002).

Ferrin, T.E. et al. Het MIDAS weergavesysteem. J. Mol. Grafiek. 6, 13–27 (1988).

Harpaz, Y. et al. Directe waarneming van een betere hydratatie aan het N-uiteinde van een α-helix met glycine in plaats van alanine als het N-cap-residu. Proc. Natl Acad. Wetenschap. VS 91, 3–15 (1994).

Bycroft, M. et al. Bepaling van de driedimensionale structuur van barnase met behulp van nucleaire magnetische resonantie spectroscopie. Biochemie 30, 8697–8701 (1991).

Clarke, N.D. et al. Structurele studies van het engrailed homeodomein. prot. Wetenschap. 3, 1779–1787 (1994).


INVOERING

Peptidesequenties met een lengte van minder dan 20 residuen kunnen sterke structurele voorkeuren hebben die onafhankelijk zijn van niet-lokale interacties, zoals aangetoond door NMR, 1𠄳 en simulatiestudies. 4,5 Er wordt gedacht dat sequentiepatronen voor deze peptiden in de context van een oudersequentie vroeg in het vouwen gestructureerd worden en in hun natieve conformatie voorkomen in ongevouwen eiwitten. Sommige van deze korte sequentiepatronen, met een lengte van 3� residuen, zijn vastgelegd in een bibliotheek met structurele motieven genaamd I-sites (initiatieplaatsen) 6 en het bijbehorende verborgen Markov-model (HMMSTR) 7 dat de aangrenzen en afhankelijkheden van I- sites-motieven in de eiwitstructuurdatabase.

Het bestaan ​​van sterke sequentie-structuurcorrelaties in de database zou ons in staat moeten stellen om vouwmogelijkheden te ontwikkelen en te testen voor template-vrije eiwitstructuurvoorspelling. Op kennis gebaseerde mogelijkheden op basis van de statistische voorkomen van structurele eigenschappen in natieve eiwitten hebben bewezen de meest succesvolle benadering te zijn voor het voorspellen van de eiwitstructuur. 8,9 Ze bieden een aantrekkelijk alternatief voor op moleculaire mechanica gebaseerde krachtvelden omdat ze aanzienlijk minder details vereisen en niet afhankelijk zijn van de aanname dat thermodynamische berekeningen kunnen worden geëxtrapoleerd om complexe macromoleculaire interacties te modelleren. 10

Over het algemeen zijn er twee soorten statistische potentialen, een die interacties omvat voor alle residu-specifieke atoomtypes en andere die grofkorrelig zijn, met slechts een of twee residu-specifieke interactiecentra gecreëerd door “uniting” atomen. 14� Lumping atoms together into interaction centers has been particularly useful in protein structure prediction as it significantly reduces the cost of computing a search for the native structure in hyper-dimensional protein configuration space. However, simplified representations lose some of the detailed geometric dependence on the calculated energy of the system. In particular, hydrogen bond energy depends strongly on the orientation, not just on the distance between interaction centers.

In this study we use a reduced protein representation for folding simulations in an α-carbon-only folding potential. Peptide residues are treated as beads on a string, with backbone atoms for each residue lumped into a single interaction center located at the position of each α-carbon. Additionally, side chain centroids are approximated by the mean relative positions of the side chain centers of mass. Such a model can significantly reduce the cost of computing trajectories to visualize long time-scale dynamics such as in protein folding. 17

In protein structure prediction, effort has been made to discretize the conformational space by fragment insertion Monte Carlo 18 or chain build-up 19,20 in folding simulations. Although quite successful, these methods may ignore intermediates along the folding pathway by strictly optimizing the global fold energy. 21 Modeling folding pathways is essential to the understanding of folding kinetics and kinetic stability. Non-native intermediates along the folding pathways may be required in the folding of some knotted proteins. 22

Recently, there has been increased interest in simulating the physical folding process using reduced protein representations and coarse-grained potentials. 23� To our knowledge, no α-carbon-only statistical potential for folding by molecular dynamics simulations has ever before been tried, as very few of the published statistical potentials act solely on α-carbons, 26� hinting at the difficulty of calculating a realistic energy using a reduced model.


Referenties

Kendrew, J. C. et al. A three-dimensional model of the myoglobin molecule obtained by X-ray analysis. Natuur 181, 662–666 (1958).

Perutz, M. F. et al. A three-dimensional fourier synthesis at 5.5-Å resolution, obtained by X-ray analysis. Natuur 185, 416–422 (1960).

Blake, C. C. et al. Structure of hen egg-white lysozyme. A three-dimensional Fourier synthesis at 2 Å resolution. Natuur 206, 757–761 (1965).

Matthews, B. W., Sigler, P. B., Henderson, R. & Blow, D. M. Three-dimensional structure of tosyl-α-chymotrypsin. Natuur 214, 652–656 (1967).

Wyckoff, H. W. et al. The structure of ribonuclease-S at 3.5 Å resolution. J. Biol. Chem. 242, 3984–3988 (1967).

Lipscomb, W. N., Hartsuck, J. A., Quiocho, F. A. & Reeke, G. N. Jr. The structure of carboxypeptidase A. IX. The x-ray diffraction results in the light of the chemical sequence. Proc. Natl Acad. Wetenschap. VS 64, 28–35 (1969).

Arnone, A. et al. A high resolution structure of an inhibitor complex of the extracellular nuclease of Staphylococcus aureus. I. Experimental procedures and chain tracing. J. Biol. Chem. 246, 2302–2316 (1971).

Perutz, M. F. Stereochemistry of cooperative effects in haemoglobin. Natuur 228, 726–739 (1970).

Epstein, C. J., Goldberger, R. F. & Anfinsen, C. B. The genetic control of tertiary protein structure. Model systems. Cold Spring Harb. Symp. aantal. Biol. 28, 439–449 (1963).

Levinthal, C. in Mossbauer Spectroscopy in Biological Systems (eds Debrunner, P. et al.) 22–24 (University of Illinois Press, Urbana, Illinois, 1969).

Ptitsyn, O. B. Stages in the mechanism of self-organization of protein molecules. Dokl. Akad. Nauk SSSR 210, 1213–1215 (1973) (in Russian).

Kim, P. S. & Baldwin, R. L. Specific intermediates in the folding reactions of small proteins and the mechanism of protein folding. Ann. ds. Biochem. 51, 459–489 (1982).

Karplus, M. & Weaver, D. L. Diffusion-collision model for protein folding. Biopolymers 18, 1421–1437 (1979).

Dolgikh, D. A. et al. α-Lactalbumin: compact state with fluctuating tertiary structure? FEBS Lett. 136, 311–315 (1981).

Creighton, T. E. The two-disulphide intermediates and the folding pathway of reduced pancreatic trypsin inhibitor. J. Mol. Biol. 95, 167–199 (1975).

Cohen, S. N., Chang, A. C., Boyer, H. W. & Helling, R. B. Construction of biologically functional bacterial plasmids in vitro. Proc. Natl Acad. Wetenschap. VS 70, 3240–3244 (1973).

Shortle, D. A genetic system for analysis of staphylococcal nuclease. Gen 22, 181–189 (1983).

Perry, L. J., Heyneker, H. L. & Wetzel, R. Non-toxic expression in Escherichia coli of a plasmid-encoded gene for phage T4 lysozyme. Gen 38, 259–264 (1985).

Hartley, R. W. Barnase and barstar. Expression of its cloned inhibitor permits expression of a cloned ribonuclease. J. Mol. Biol. 202, 913–915 (1988).

Sanger, F. et al. Nucleotide sequence of bacteriophage ϕ X174 DNA. Natuur 265, 687–695 (1977).

Hutchison, C. A., et al. Mutagenesis at a specific position in a DNA sequence. J. Biol. Chem. 253, 6551–6560 (1978).

Winter, G., Fersht, A. R., Wilkinson, A. J., Zoller, M. & Smith, M. Redesigning enzyme structure by site-directed mutagenesis: tyrosyl tRNA synthetase and ATP binding. Natuur 299, 756–758 (1982).

Matouschek, A., Kellis, J. T. Jr., Serrano, L. & Fersht, A. R. Mapping the transition state and pathway of protein folding by protein engineering. Natuur 340, 122–126 (1989).

Fersht, A. R., Leatherbarrow, R. J. & Wells, T. N. Structure–activity relationships in engineered proteins: analysis of use of binding energy by linear free energy relationships. Biochemie 26, 6030–6038 (1987).

Itzhaki, L. S., Otzen, D. E. & Fersht, A. R. The structure of the transition state for folding of chymotrypsin inhibitor 2 analysed by protein engineering methods: evidence for a nucleation-condensation mechanism for protein folding. J. Mol. Biol. 254, 260–288 (1995).

Daggett, V. & Fersht, A. R. Is there a unifying mechanism for protein folding? TrendsBiochem. Wetenschap. 28, 18–25 (2003).

Levitt, M. & Lifson, S. Refinement of protein conformations using a macromolecular energy minimization procedure. J. Mol. Biol. 46, 269–279 (1969).

McCammon, J. A., Gelin, B. R. & Karplus, M. Dynamics of folded proteins. Natuur 267, 585–590 (1977).

Daggett, V. & Fersht, A. The present view of the mechanism of protein folding. Natuur Ds. Mol. Cel Biol. 4, 497–502 (2003).

Williamson, M. P., Havel, T. F. & Wuthrich, K. Solution conformation of proteinase inhibitor IIA from bull seminal plasma by 1 H nuclear magnetic resonance and distance geometry. J. Mol. Biol. 182, 295–315 (1985).

Baum, J., Dobson, C. M., Evans, P. A. & Hanley, C. Characterization of a partly folded protein by NMR methods: studies on the molten globule state of guinea pig α-lactalbumin. Biochemie 28, 7–13 (1989).

Bax, A. & Grishaev, A. Weak alignment NMR: a hawk-eyed view of biomolecular structure. Curr. Opin. structuur Biol. 15, 563–570 (2005).

Religa, T. L., Markson, J. S., Mayor, U., Freund, S. M. & Fersht, A. R. Solution structure of a protein denatured state and folding intermediate. Natuur 437, 1053–1056 (2005).

Korzhnev, D. M. & Kay, L. E. Probing invisible, low-populated states of protein molecules by relaxation dispersion NMR spectroscopy: an application to protein folding. acc. Chem. Onderzoek 41, 442–451 (2008).

Hvidt, A. & Linderstrøm-Lang, K. Exchange of hydrogen atoms in insulin with deuterium atoms in aqueous solutions. Biochim. Biofysica. Acta 14, 574–575 (1954).

Englander, S. W., Mayne, L., Bai, Y. & Sosnick, T. R. Hydrogen exchange: the modern legacy of Linderstrøm-Lang. Eiwit Sc. 6, 1101–1109 (1997).

Levitt, M. & Chothia, C. Structural patterns in globular proteins. Natuur 261, 552–558 (1976).

Lander, E.S. et al. Initiële sequencing en analyse van het menselijk genoom. Natuur 409, 860–921 (2001).

Petsko, G. A. An idea whose time has gone. Genome Biol. 8, 107 (2007).

Banci, L. et al. An idea whose time has come. Genome Biol. 8, 408 (2007).

Moult, J. et al. Critical assessment of methods of protein structure prediction — Round VII. Eiwitten 69 (Suppl. 8), 3–9 (2007).

Daggett, V. & Levitt, M. Protein unfolding pathways explored through molecular dynamics simulations. J. Mol. Biol. 232, 600–619 (1993).

Mayor, U. et al. The complete folding pathway of a protein from nanoseconds to microseconds. Natuur 421, 863–867 (2003).

Vendruscolo, M., Paci, E., Dobson, C. M. & Karplus, M. Three key residues form a critical contact network in a protein folding transition state. Natuur 409, 641–645 (2001).

Gianni, S. et al. Unifying features in protein-folding mechanisms. Proc. Natl Acad. Wetenschap. VS 100, 13286–13291 (2003).

Fink, A. L. Natively unfolded proteins. Curr. Opin. structuur Biol. 15, 35–41 (2005).

Wells, M. et al. Structure of tumor suppressor p53 and its intrinsically disordered N-terminal transactivation domain. Proc. Natl Acad. Wetenschap. VS 105, 5762–5767 (2008).

Chiti, F. & Dobson, C. M. Protein misfolding, functional amyloid, and human disease. Ann. ds. Biochem. 75, 333–366 (2006).

Jones, P. T., Dear, P. H., Foote, J., Neuberger, M. S. & Winter, G. Replacing the complementarity-determining regions in a human antibody with those from a mouse. Natuur 321, 522–525 (1986).

Jiang, L. et al. De novo computational design of retro-aldol enzymes. Wetenschap 319, 1387–1391 (2008).

Rothlisberger, D. et al. Kemp elimination catalysts by computational enzyme design. Natuur 453, 190–195 (2008).

Maxam, A. M. & Gilbert, W. A new method for sequencing DNA. Proc. Natl Acad. Wetenschap. VS 74, 560–564 (1977).


Bekijk de video: Ceramah Terbaik Ustaz Wadi Anuar Padat Dengan Ilmu Dan Nasihat Berguna (December 2021).