Informatie

Waarom zijn transmembraaneiwitten moeilijk te kristalliseren?


ik weet dat in vivo dat er in het algemeen veel minder transmembraneuze eiwitten zijn en dat ze in een lager tempo worden geproduceerd dan hun vrije tegenhangers. Dit komt voornamelijk omdat transmembraaneiwitten alleen nodig zijn in een 2D-ruimte op het membraan in plaats van een 3D-cytoplasmatische of extracellulaire ruimte. Dit betekent (nogmaals, heel globaal gesproken) dat de kans dat ze met hun doelwit in aanraking komen groter is.

Ik weet ook dat dit een van de redenen is dat het produceren van kristallen voor röntgenkristallografie notoir moeilijk is voor transmembraaneiwitten. Wat zijn de andere redenen die transmembraaneiwitten typisch taaie kristallisatiekandidaten maken?

Welk specifiek deel van het kristallisatieproces levert zulke slechte succespercentages op voor de opheldering van de transmembraaneiwitstructuur?


Er zijn verschillende factoren die het verkrijgen van kristalstructuren uit membraaneiwitten moeilijker maken. Kortom, bijna elke fase van het verkrijgen van de structuur via kristallografie is moeilijker.

Eerst: eiwit expressie. Er zijn grote hoeveelheden zuiver, goed gevouwen eiwit nodig en dit is veel moeilijker te bereiken dan met een oplosbaar eiwit. Omdat membraaneiwitten in een membraan zijn gebonden, zijn de mechanismen om het peptide in het membraan te vertalen en het eiwit in het membraan te vouwen verschillend. Het kan gaan om vouwfactoren die alleen in een bepaald compartiment van de cel beschikbaar zijn (waardoor bacteriën als expressiesysteem onmogelijk zijn). In grote hoeveelheden in de cel kan hun hydrofobiciteit de neiging hebben om te resulteren in klompjes ongevouwen eiwit in plaats van klodders membraan-geassocieerd eiwit.

Volgende: Het eiwit zuiveren is moeilijker. De tot expressie brengende cellen worden gewoonlijk opengebroken in aanwezigheid van detergent om de eiwitten te laten rondzweven als individuele eiwitten in detergentmicellen. De verkeerde wasmiddelen kunnen het membraaneiwit afbreken en het kan zijn vouw verliezen - de concentratie van het wasmiddel moet zorgvuldig worden beheerd en op een optimaal niveau worden gehouden, anders kunnen de micellen uiteenvallen en wordt het eiwit vernietigd.

Het eiwit kristalliseren is ook een stuk moeilijker. Membraaneiwitten in wasmiddelmicellen die al dan niet zelf geladen kunnen zijn, zien eruit als olieachtige klodders met hopelijk een domein of twee gevouwen eiwitten die eruit steken. Vergeleken met een oplosbaar eiwit met een mooi geordend oppervlak in elke richting in plaats van een wasmiddelmicel die een faseverandering zou kunnen ondergaan bij hoge concentratie of door de toevoeging van een zout of een verandering in pH, nemen membraaneiwitten een taak op zich die duizenden proeven zou kunnen vergen en voegt nieuwe dimensies toe om je zorgen over te maken.

De eiwitten zijn 2D-achtig, maar de kristallen moeten nog steeds 3D zijn om kristallografie normaal te laten werken. Eiwitkristallen zijn klein, maar die afgeleid van membraaneiwitten - die de neiging hebben zich te organiseren in vlakken zoals de membranen die ze bewonen - zijn vaak dun, waardoor ze te delicaat en te klein kunnen worden om een ​​goede set gegevens te krijgen, zelfs van synchrotronstralen. Als gevolg hiervan zijn de kristallen gewoonlijk te klein of te dun om in het begin te gebruiken, wat een uitgebreide optimalisatie vereist nadat het eerste kristal is gevonden.

In enkele gevallen zijn sommige membraaneiwitten opgelost met 2D-kristallen met behulp van elektronenmicroscopie op kristallijne arrays van porines en rodopsines in membranen. Dat was een hoop werk, maar het waren jaren en jaren de eerste membraaneiwitstructuren.

Om dit alles niet onmogelijk te maken - als je eenmaal kristallen hebt, kunnen ze meestal worden verbeterd; er zijn goede uitgangspunten voor kristallisatie en zuivering met detergentia. Alleen duurt een proces dat al behoorlijk wat tijd (jaren) kan duren en soms tot frustratie kan leiden nog langer en is bij een membraaneiwit minder zeker.


Transmembraan eiwit

Membraaneiwitten hebben, net als alle eiwitten, een eindige levensduur. De levensduur van een eiwit wordt bepaald door de snelheid van synthese en de snelheid van afbraak. Degradatie wordt gedomineerd door twee fenomenen: targeting van het eiwit voor verwijdering, vaak door proteolyse door een systeem dat wordt geactiveerd via de ubiquitine-route, en denaturatie van het eiwit (wat vervolgens kan leiden tot targeting en proteolyse). Het begrijpen van denaturatie van een eiwit vereist een algemeen begrip van eiwitstabiliteit (denaturatie, zoals het hier zal worden gebruikt, is het verlies van secundaire en tertiaire structuur samengaand met het verlies van functie).

Sommige in water oplosbare eiwitten kunnen, onder nauwkeurig gedefinieerde omstandigheden, worden gedenatureerd, inclusief functieverlies, en vervolgens worden gerenatureerd met functiewinst. Experimentele waarnemingen van dit soort gedrag leidden tot het concept dat deze eiwitten in een waterige omgeving zich op of nabij het punt van de laagste totale vrije energie in hun oorspronkelijke structuur bevonden. Hoewel er veel discussie is geweest over het vrije-energielandschap dat deze eiwitten ervaren, lijdt het geen twijfel dat de vrije energie stelt dat een dergelijke eiwitervaring in een bepaalde waterige omgeving verloren kan gaan en weer kan worden teruggewonnen in een denaturatie/renaturatie-experiment.

Membraaneiwitten moeten flexibel genoeg zijn om de conformationele veranderingen die nodig zijn voor hun biologische functie mogelijk te maken. De structuur moet echter voldoende stabiel zijn om voortijdige denaturatie te voorkomen. Verder is de structuur van het membraaneiwit niet alleen ontworpen om zich aan te passen aan de lipidedubbellaag, maar waarschijnlijk ook gestabiliseerd door de lipidedubbellaag.

Bijgevolg vertonen transmembraaneiwitten, in vrijwel alle tot nu toe onderzochte gevallen, stabiliteitskenmerken die significant verschillen van oplosbare eiwitten. Als de discussie beperkt blijft tot transmembraaneiwitten die zijn gebouwd op helixbundels in het transmembraandomein, dan zeggen beschikbare experimenten dat denaturatie van dergelijke eiwitten onomkeerbaar is (sommige β-barrel-membraaneiwitten kunnen worden gedenatureerd en gerenatureerd, maar hun oplosbaarheidseigenschappen zijn anders vanwege de vaak polaire poriën van de β-barrel). 49 Het hydrofobe effect en de structuur van deze transmembraaneiwitten voorspellen dit resultaat. Om te denatureren, wat inhoudt dat de secundaire en tertiaire structuur verloren gaat, moeten de transmembraanhelices zich ontvouwen en zo alle interne waterstofbruggen verbreken. Deze intrahelische waterstofbruggen stabiliseren de polaire N-H- en C-O-groepen van de peptidebindingen in het hydrofobe binnenste van het membraan. Door die bindingen te verbreken, blijven deze polaire groepen blootgesteld in een hydrofoob milieu. Dit is thermodynamisch ongunstig. Evenzo zou verwijdering van het transmembraaneiwit van het membraan naar het waterige medium, wat waterstofbinding van die groepen aan water mogelijk zou maken, tegelijkertijd de hydrofobe aminozuurzijketens blootstellen aan water, ook thermodynamisch ongunstig. Daarom is verlies van secundaire structuur in het transmembraandomein onwaarschijnlijk bij thermodenaturatie, totdat extreme temperaturen worden bereikt.

Meer waarschijnlijke resultaten van thermische denaturatie bij gematigde temperaturen zijn: (1) expansie in het vlak van de dubbellaag (sterk geordende dubbellagen remmen denaturatie van membraaneiwitten), (2) aggregatie in het vlak van het membraan, en (3) verlies van structuur in de extramembrane domeinen van het eiwit. Bij CD-experimenten met denaturatie van transmembraaneiwitten wordt weinig verlies van de helixstructuur in het transmembraandomein gezien. Experimentele waarnemingen geven aan dat het zo behandelde membraaneiwit niet gemakkelijk in zijn oorspronkelijke staat kan worden teruggebracht.

De stabiliteit van membraaneiwitten kan experimenteel worden onderzocht met behulp van differentiële scanningcalorimetrie. 50,51 Deze experimenten tonen aan dat door warmte geïnduceerde denaturatie van het membraaneiwit onomkeerbaar is. Dit betekent dat evenwichtsthermodynamica niet kan worden gebruikt om dergelijke overgangen te begrijpen, omdat evenwichtsthermodynamica microscopische omkeerbaarheid in de reactie vereist. Er kunnen echter activeringsenergieën voor de overgangen worden bepaald. De experimenten hebben aangetoond dat ten minste sommige membraaneiwitten kinetisch gestabiliseerd zijn, niet thermodynamisch gestabiliseerd. Ze hebben geen minimum aan gratis energie. Ze bevinden zich waarschijnlijk op een lokaal minimum, maar niet op een wereldwijd minimum, in het energielandschap. Het is waarschijnlijk dat de aandoening de biologische functies bevordert die deze membraaneiwitten vertonen. Het zorgt voor een aanzienlijke conformationele flexibiliteit (voor de conformationele veranderingen die nodig zijn in enzymatische reacties) zonder denaturatie terwijl het eiwit zich in een lipide dubbellaag bevindt.

Deze experimenten bepalen ook een levensduur voor de actieve toestand van het membraaneiwit. Uitgaande van een denaturatiereactie van de eerste orde, vervallen deze membraaneiwitten tot een inactieve toestand met een gedefinieerde halfwaardetijd. In deze visie bieden membranen een gespecialiseerde omgeving voor het membraaneiwit dat de functie van het membraaneiwit optimaliseert met de bijbehorende prijs dat het membraaneiwit een eindige levensduur heeft in die geoptimaliseerde toestand.


G4. Voorspelling van membraaneiwitstructuur

  • Bijgedragen door Henry Jakubowski
  • Professor (Chemie) aan het College van St. Benedict/St. John's Universiteit

Tot nu toe hebben we voornamelijk globulaire eiwitten besproken die oplosbaar zijn in water. Eiwitten worden ook gevonden geassocieerd met membranen. In de natuur worden twee hoofdklassen van membraaneiwitten aangetroffen.

  • perifere membraaneiwitten: in water oplosbare eiwitten binden reversibel en niet-covalent aan het membraan door elektrostatische aantrekkingen tussen geladen polaire kopgroepen van de fosfolipiden en het eiwit. Deze eiwitten kunnen vaak van het membraan worden vrijgemaakt door toevoeging van een hoog zoutgehalte, omdat ze vaak worden aangetrokken door de dubbellaag door elektrostatische interacties tussen geladen fosfolipidekopgroepen en polaire/geladen groepen op het eiwitoppervlak.
  • integrale membraaneiwitten: eigenlijk invoegen in de dubbellaag. Deze kunnen van het membraan worden vrijgemaakt en effectief worden opgelost door toevoeging van amfifielen met een enkele keten (detergentia) die een gemengde micel vormen met het integrale membraaneiwit. Niet-ionische detergentia (Trition X-100, octylglucoside, enz.) worden vaak gebruikt bij de zuivering van membraaneiwitten. Ionische detergentia (zoals SDS) lossen niet alleen de integrale membraaneiwitten op, maar denatureren ze ook.

Figuur: Soorten membraaneiwitten

In sommige van deze integrale membraaneiwitten zijn grote extracellulaire en intracellulaire domeinen van het eiwit aanwezig, verbonden door de intramembraangebieden. Het intramembraan overspannende gebied bestaat vaak uit ofwel een enkele alfa-helix, of 7 verschillende spiraalvormige gebieden die door het membraan zigzaggen. Deze transmembraansequenties kunnen gemakkelijk worden bepaald door middel van hydropathieberekeningen. Beschouw bijvoorbeeld het integrale membraan rundereiwit rhodopsine. De volgorde van 348 aminozuren (in een enkele lettercode) wordt hieronder weergegeven:

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLY
VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG
GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP
EGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES
ATTQKAEKEVTRRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTAV
YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Rhodopsine hydropathie plot berekeningen laten zien dat het zeven transmembraan helices bevat die op een kronkelige manier door het membraan kronkelen.

Figuur: Rhodopsine hydropathie plot

Figuur: zeven transmembraanhelices

Resultaten van rodopsinehydropathie

Nee. N-terminal transmembraangebied C-aansluiting type lengte
1 40 LAAYMFLLIMLGFPINFLTLYVT 62 PRIMAIRE 23
2 71 PLNYILLNLAVADLFMVFGGFTT 93 ONDERGESCHIKT 23
3 113 EGFFATLGGEIALWSLVVLAIER 135 ONDERGESCHIKT 23
4 156 GVAFTWVMALACAAPPLVGWSRY 178 ONDERGESCHIKT 23
5 207 MFVVHFIIPLIVIFFCYGQLVFT 229 PRIMAIRE 23
6 261 FLICWLPYAGVAFYIFTHQGSDF 283 PRIMAIRE 23
7 300 VYNPVIYIMMNKQFRNCMVTTLC 322 ONDERGESCHIKT 23

Samengevat zijn hydropathiegrafieken daarom nuttig bij het vinden van begraven gebieden in wateroplosbare eiwitten, transmembraanhelices in integrale membraaneiwitten evenals korte stukken polaire/geladen aminozuren die oppervlaktelussen zouden kunnen vormen die herkenbaar zijn door antilichamen van het immuunsysteem. De venstergrootte die in hydropathieplots wordt gebruikt, zou uiteraard van invloed zijn op de berekende resultaten. Vensters van 20 aminozuren zijn nuttig om transmembraanhelices te bepalen, terwijl vensters van 5-7 aminozuren worden gebruikt om aan het oppervlak blootgestelde hydrofiele plaatsen te vinden.

Membraaneiwitten worden opgelost door toevoeging van amfifielen met een enkele keten (detergentia). De niet-polaire staarten van de detergentia interageren met het hydrofobe transmembraandomein van het membraaneiwit en vormen een "gemengde" micelachtige structuur. Niet-ionische detergentia zoals Triton X-100 en octyl-glucoside worden vaak gebruikt om membraaneiwitten in hun bijna natuurlijke staat op te lossen. Daarentegen denatureren ionische detergentia zoals natriumdedecylsulfaat (met een negatief geladen kopgroep) eiwitten tijdens het solubilisatieproces. Om membraaneiwitten in een meer natieve omgeving te bestuderen, kunnen eiwitten die oplosbaar zijn gemaakt door een niet-ionisch detergens worden gereconstitueerd in tweelagige liposoomstructuren met behulp van methoden die vergelijkbaar zijn met die van Lab 1 waarin u met kleurstof ingekapselde grote unilamellaire blaasjes (LUV's) hebt bereid. Het kan echter moeilijk zijn om de intra- en extracellulaire domeinen van membraaneiwitten in liposomen te bestuderen, aangezien een van die domeinen verborgen is in het liposoom. Onlangs heeft Sligar een nieuwe techniek ontwikkeld die deze barrière wegneemt. Hij creëerde een amfifiele eiwitschijf met een opening in het midden. De binnenste opening is bekleed met niet-polaire resten, terwijl het buitenoppervlak van de schijf polair is. Toen de schijven aan fosflipiden werden toegevoegd, vormden zich kleine dubbellagen in de schijf. Membraaneiwitten zoals de b-2-adrenerge receptor zouden kunnen worden gereconstitueerd in de nanodisc-dubbellagen, waardoor blootstelling aan oplosmiddelen van zowel de intracellulaire als extracellulaire domeinen van het receptoreiwit mogelijk is.


Membraan Eiwitten

4 Type I. Enkele transmembraan -Helix: Glycophorin

Omdat erytrocyten, in tegenstelling tot andere menselijke cellen, geen ingewikkelde interne membranen hebben en gemakkelijk in zuivere vorm uit bloed kunnen worden verkregen, hebben ze tientallen jaren gediend als het "laboratorium voor membraanstudies". Veel van de klassieke biochemische en biofysische membraanonderzoeken die in latere hoofdstukken worden besproken, werden eerst op erytrocyten uitgewerkt, en veel van de membraaneiwitonderzoeken werden eerst op intern glycoforine gedaan. Ondanks het feit dat glycoforine een van de meest bestudeerde membraaneiwitten is, blijft de biologische functie ervan echter onzeker. Glycoforinen a en b zijn de belangrijkste glycoproteïnen in het erytrocytenplasmamembraan en dragen de antigene determinanten voor de MN- en Ss-bloedgroepen. Op gewichtsbasis is 60% van glycoforine koolhydraten die volledig aan het buitenste bladoppervlak van het eiwit zijn gehecht. Overvloedige siaalzuren ( Hoofdstuk 7 ) geven een negatieve lading aan het buitenoppervlak van de erytrocyten. De negatieve ladingen op glycoforine zorgen ervoor dat de erytrocyten elkaar afstoten, waardoor ze niet samenklonteren in het bloed. Met het ouder worden veroorzaakt het verlies van suikers de vernietiging van oude erytrocyten.

Glycophorine a is een integraal eiwit met één spanwijdte van 131 aminozuren waarvan de cartoonstructuur is weergegeven in Fig. 6.7 [19]. Alle koolhydraten van glycophorine zijn gehecht aan aminozuren op het N-terminale, buitenste segment. Deze koolhydraten zijn gehecht aan slechts enkele van de eerste 50 aminozuren van de buitenste sequentie van 80 aminozuren van glycophorin. Net als bij cytochroom b5, kan dit extracellulaire segment worden gesplitst door trypsine. De aangehechte suikertetrasachariden zijn O-gebonden aan serine of threonine, terwijl de grotere oligosachariden N-gebonden zijn aan asparagines. O-gebonden serine en threonine en N-gebonden asparagine zijn de gebruikelijke manier waarop suikers worden gekoppeld aan membraaneiwitten (Hoofdstuk 7). Glycophorine a wordt in het membraan vastgehouden via een 22-aminozuur single span transmembraan a-helix [20]. Ten slotte heeft glycoforine a een C-terminaal segment van 29 aminozuren dat zich uitstrekt tot in de waterige ruimte in het inwendige van de erytrocyten. Dit segment is volledig vrij van suikers. Zowel de N-terminale als de C-terminale niet-membraandomeinen hebben veel hydrofiele aminozuren die niet worden gevonden in het transmembraan-a-helixsegment. Glycophorine a wordt op zijn plaats gehouden door een α-helix die wordt geflankeerd door de positief geladen aminozuren, lysine en arginine. Deze kationische aminozuren interageren met de negatief geladen fosfolipidekopgroepen. In het erytrocytmembraan komt glycoforine a waarschijnlijk voor als dimeren die een opgerolde structuur vormen waarbij de a-helices betrokken zijn.

Afbeelding 6.7 . Cartoonstructuur van glycoforine met extracellulaire (N-terminale), transmembraan (α-helix) en intracellulaire (C-terminale) domeinen [19].


Structurele biologie van G-eiwit-gekoppelde receptoren: nieuwe kansen van XFEL's en cryoEM

Recente ontwikkelingen in cryoEM en XFEL's versnelden structurele studies van GPCR's.

XFEL's maakten schadevrije structuren bij kamertemperatuur mogelijk van kristallen van micrometerformaat.

CryoEM heeft zijn potentieel aangetoond voor het ophelderen van GPCR-signaleringscomplexen.

Zowel cryoEM als XFEL's beloven licht te werpen op de structurele dynamiek van GPCR's.

G-eiwit-gekoppelde receptoren bemiddelen celsignalering en reguleren de meeste sensorische en fysiologische processen in het menselijk lichaam. Recente doorbraken in cryo-elektronenmicroscopie en röntgenvrije elektronenlasers hebben structurele studies van moeilijk te kristalliseren receptoren en hun signaalcomplexen versneld, en hebben nieuwe mogelijkheden geopend voor het begrijpen van conformationele dynamiek en het visualiseren van het proces van receptoractivering met ongekende ruimtelijke en temporele resolutie. Hier vatten we belangrijke mijlpalen en uitdagingen samen die verband houden met de toepassing van deze technieken en schetsen we toekomstige richtingen in hun ontwikkeling met een focus op structurele biologie van membraaneiwitten.


Hoorcollege 2 - analyse van structuur en functie van membraaneiwitten

Röntgenkristallografie = wordt gebruikt om de precieze rangschikking van atomen in een kristal van een monster van uw eiwit van belang te bepalen/identificeren. Om uiteindelijk de 3-dimensionale structuur van de biologische macromoleculen zoals eiwitten op te lossen, wordt bepaald door röntgendiffractie.
Röntgenstralen bieden de beste resolutie voor het bepalen van de moleculaire structuur, aangezien de golflengte ervan overeenkomt met de golflengte van een covalente binding. Er is dus een lage golflengte van de röntgenstraling nodig voor een betere resolutie om een ​​resolutie van 2-3 A te kunnen bereiken. Deze resolutie tussen dit bereik is belangrijk om de aminozuurresiduen en zijketens van een eiwit te bepalen.

-Regelmatigheid wordt gehandhaafd in het kristal omdat moleculen in een vaste en regelmatige rangschikking ten opzichte van elkaar zijn georiënteerd, die allemaal dezelfde 3D-structuur en grootte hebben. Eiwitkristallisatie is een hele uitdaging om een ​​geconcentreerde oplossing van een zeer zuiver eiwitmonster te verkrijgen. Omdat veranderingen in de grootte van de kristallen het diffractiepatroon zullen beïnvloeden dat wordt gebruikt om de structuur van het membraaneiwit nauwkeurig te bepalen.

-pH, temperatuur en andere parameters die de kristallisatie beïnvloeden - hebben vervolgens allemaal het effect dat kristallen van voldoende kwaliteit kunnen groeien (een geconcentreerde oplossing van zeer zuiver eiwit)

- Oorsprong en interpretatie van het diffractiepatroon (de wet van Bragg - een natuurkundige wet die laat zien dat de diffractiestralen weerkaatsen op de kristalstructuren).

- Diffractiepatroonverwerking (Fourier-transformatie is de toevoeging van verschillende sinusgolven om de structuur te berekenen met behulp van de elektronendichtheidskaart, de dichtheid van elektronen in de echte ruimte)


5. Oververzadiging, nucleatie en groei van kristallen  

Kristallisatie van een molecuul of verzameling van sommige chemische soorten, inclusief eiwitten, verloopt in twee nogal verschillende maar onafscheidelijke stappen: kiemvorming en groei. Nucleatie is het moeilijkste probleem om theoretisch en experimenteel aan te pakken, omdat het een faseovergang van de eerste orde vertegenwoordigt waarbij moleculen van een geheel ongeordende toestand naar een geordende toestand gaan. Vermoedelijk gebeurt dit door de vorming van gedeeltelijk geordende of parakristallijne tussenproducten, in dit geval eiwitaggregaten met een korte-afstandsorde, en levert dit uiteindelijk kleine, volledig geordende assemblages op die we kritische kernen noemen.

Kritische kernen moeten worden beschouwd in termen van de moleculaire afmetingen, de oververzadiging en de vrije oppervlakte-energie van moleculaire toevoeging. Momenteel is de kritische nucleaire grootte slechts voor enkele systemen beschreven, en voor verschillende gevallen werden deze alleen onderzocht in termen van tweedimensionale kernen die zich ontwikkelden op het oppervlak van reeds bestaande kristallen (Malkin et al., 1996 ▶, 1997 ▶). Onlangs is een theorie naar voren gekomen die het nucleatiefenomeen probeert te verklaren in termen van statistische fluctuaties in oplossingseigenschappen (Ten Wolde & Frenkel, 1997 ▶ Haas & Drenth, 1999 ▶ Piazza, 1999 ▶ Kuznetsov et al., 1998 ▶). Dit idee houdt in dat zich in geconcentreerde eiwitoplossingen een kenmerkende ‘vloeibare eiwitfase’x02019 vormt en dat deze �seâ’ uiteindelijk aanleiding geeft tot kritische kernen met een alomvattende ordening. Dit idee wordt nu bestudeerd met behulp van een verscheidenheid aan experimentele technieken in tal van laboratoria.

De groei van macromoleculaire kristallen is een beter gekarakteriseerd proces dan kiemvorming, en de mechanismen ervan zijn redelijk goed begrepen. Eiwitkristallen groeien voornamelijk door de klassieke mechanismen van dislocatiegroei en groei door tweedimensionale nucleatie, samen met twee andere minder gebruikelijke mechanismen die bekend staan ​​als normale groei en driedimensionale nucleatie (Malkin et al., 1995 ▶ McPherson & Malkin, 2000 ▶). Een gemeenschappelijk kenmerk van kiemvorming en groei is dat beide kritisch afhankelijk zijn van wat wordt genoemd de oververzadiging van de moederloog die aanleiding geeft tot de kristallen. Oververzadiging is de variabele die beide processen aandrijft en bepaalt hun optreden en omvang en de kinetiek die ze beheersen.

Kristallisatie van een macromolecuul vereist absoluut het creëren van een oververzadigde toestand. Dit wordt geïllustreerd door het fasediagram voor kristalgroei weergegeven in Fig. 3 ▶. Oververzadiging is een niet-evenwichtstoestand waarin een bepaalde hoeveelheid van het macromolecuul boven de oplosbaarheidsgrens, onder specifieke chemische en fysische omstandigheden, niettemin in oplossing aanwezig is. Het evenwicht wordt hersteld door de vorming en ontwikkeling van een vaste toestand, zoals kristallen, wanneer de verzadigingsgrens wordt bereikt. Om de oververzadigde oplossing te produceren, moeten de eigenschappen van een onderverzadigde oplossing worden gewijzigd om het vermogen van het medium om het macromolecuul op te lossen te verminderen (d.w.z. de chemische activiteit ervan verminderen), of een eigenschap van de macromoleculen moet worden gewijzigd om hun oplosbaarheid te verminderen en/of om de aantrekkingskracht van het ene macromolecuul voor het andere te vergroten. In alle gevallen zijn de relaties tussen oplosmiddel en opgeloste stof, of tussen de macromoleculen in oplossing, verstoord om de vorming van de vaste toestand te bevorderen.

Het fasediagram voor de kristallisatie van macromoleculen. Het oplosbaarheidsdiagram is scherp verdeeld in een gebied van onderverzadiging en een gebied van oververzadiging door de lijn die de maximale oplosbaarheid aangeeft bij specifieke concentraties van een neerslagmiddel, dat zout of een polymeer kan zijn. De lijn geeft het evenwicht weer tussen het bestaan ​​van de vaste fase en de vrije-molecuulfase. Het gebied van oververzadiging wordt op een meer onzekere manier verder verdeeld in de metastabiele en labiele gebieden. In het metastabiele gebied zullen kernen zich tot kristallen ontwikkelen, maar er vindt geen nucleatie plaats. In het labiele gebied kan worden verwacht dat beide voorkomen. Het laatste gebied, bij zeer hoge oververzadiging, wordt het neerslaggebied genoemd, waar dit resultaat het meest waarschijnlijk is. Kristallen kunnen alleen worden gekweekt uit een oververzadigde oplossing, en het creëren van een dergelijke oplossing die oververzadigd is in het eiwit van belang is het directe doel bij het kweken van eiwitkristallen.

Als er geen kristallen of andere vaste stoffen aanwezig zijn als de omstandigheden veranderen, zal de opgeloste stof niet onmiddellijk in twee fasen worden verdeeld en zal de oplossing in de oververzadigde toestand blijven. De vaste toestand ontwikkelt zich niet noodzakelijk spontaan als de verzadigingsgrens wordt overschreden, omdat er energie, analoog aan de activeringsenergie van een chemische reactie, nodig is om de tweede fase te creëren: de stabiele kern van een kristal of een neerslag. Een kinetische of energiebarrière (of waarschijnlijkheidsbarrière) maakt het dus mogelijk dat de omstandigheden verder van het evenwicht en verder naar de zone van oververzadiging gaan. Zodra er echter een stabiele kern in een oververzadigde oplossing verschijnt, zal deze blijven groeien totdat het systeem weer in evenwicht is. Zolang er niet-evenwichtskrachten heersen en er een zekere mate van oververzadiging bestaat om gebeurtenissen aan te drijven, zal een kristal groeien of zal zich een neerslag vormen.


Inhoud

Transmembraan lipoproteïnen Bewerken

Sommige transmembraanproteolipiden, vooral die welke in bacteriën worden aangetroffen, worden lipoproteïnen genoemd. Ze zijn niet gerelateerd aan de lipoproteïnedeeltjes waar dit artikel over gaat. [2] Dergelijke transmembraaneiwitten zijn moeilijk te isoleren, omdat ze stevig aan het lipidemembraan binden, vaak lipiden nodig hebben om de juiste structuur weer te geven en in water onoplosbaar kunnen zijn. Detergentia zijn gewoonlijk vereist om transmembraanlipoproteïnen te isoleren van hun geassocieerde biologische membranen.

Plasma lipoproteïne deeltjes Bewerken

Omdat vetten onoplosbaar zijn in water, kunnen ze niet alleen worden getransporteerd in extracellulair water, inclusief bloedplasma. In plaats daarvan zijn ze omgeven door een hydrofiele externe schaal die fungeert als transportvoertuig. De rol van lipoproteïnedeeltjes is het transporteren van vetmoleculen, zoals triacylglycerolen (ook bekend als triglyceriden), fosfolipiden en cholesterol in het extracellulaire water van het lichaam naar alle cellen en weefsels van het lichaam. De eiwitten in de externe schil van deze deeltjes, apolipoproteïnen genaamd, worden gesynthetiseerd en uitgescheiden in het extracellulaire water door zowel de dunne darm als de levercellen. De externe schil bevat ook fosfolipiden en cholesterol.

Alle cellen gebruiken en vertrouwen op vetten en cholesterol als bouwstenen om de meerdere membranen te creëren die cellen gebruiken om zowel het interne watergehalte als de interne in water oplosbare elementen te regelen en om hun interne structuur en eiwit-enzymatische systemen te organiseren. De buitenste schil van lipoproteïnedeeltjes hebben de hydrofiele groepen van fosfolipiden, cholesterol en apolipoproteïnen naar buiten gericht. Dergelijke eigenschappen maken ze oplosbaar in de op zout water gebaseerde bloedplas. Triacylglycerolen en cholesterylesters worden intern gedragen, afgeschermd van het water door de buitenste schil. Het soort apolipoproteïnen in de buitenste schil bepaalt de functionele identiteit van de lipoproteïnedeeltjes. De interactie van deze apolipoproteïnen met enzymen in het bloed, met elkaar of met specifieke eiwitten op het celoppervlak, bepaalt of triacylglycerolen en cholesterol worden toegevoegd aan of verwijderd uit de lipoproteïnetransportdeeltjes.

Karakterisering in menselijk plasma [3]

Chylomicronen VLDL LDL HDL
Elektroforetische mobiliteit Oorsprong Pre-bèta bèta Alfa
Dichtheid minder dan 0.96 0.96-1.006 1.006-1.063 1.063-1.21
Diameter (nm) 100-1000 30-90 20-25 10-20
Apolipoproteïnen B48, Al, Alle B100 CI, CII B100 AI, AII, CI
Samenstelling
(% van totale inhoud)
Eiwit 2 10 20 40
lipide 98 90 80 60
Lipide component
(% van het totale lipidegehalte)
Triacylglycerolen 88 55 12 12
cholesterolesters 4 24 59 40
fosfolipiden 8 20 28 47
Vrije vetzuren - 1 1 1

Lipoproteïnen zijn complexe deeltjes met een centrale hydrofobe kern van niet-polaire lipiden, voornamelijk cholesterylesters en triglyceriden. Deze hydrofobe kern is omgeven door een hydrofiel membraan dat bestaat uit fosfolipiden, vrij cholesterol en apolipoproteïnen. Plasmalipoproteïnen zijn onderverdeeld in zeven klassen op basis van grootte, lipidesamenstelling en apolipoproteïnen. [4]

Metabolisme Bewerken

De behandeling van lipoproteïnedeeltjes in het lichaam wordt aangeduid als: metabolisme van lipoproteïnedeeltjes. Het is verdeeld in twee routes, exogeen en endogeen, grotendeels afhankelijk van het feit of de lipoproteïnedeeltjes in kwestie voornamelijk bestaan ​​uit (exogene) voedingslipiden of dat ze afkomstig zijn uit de lever (endogeen), door middel van de novo synthese van triacylglycerolen.

De hepatocyten zijn het belangrijkste platform voor de behandeling van triacylglycerolen en cholesterol. De lever kan ook bepaalde hoeveelheden glycogeen en triacylglycerolen opslaan. Hoewel adipocyten de belangrijkste opslagcellen zijn voor triacylglycerolen, produceren ze geen lipoproteïnen.

Exogeen pad Bewerken

Gal emulgeert vetten in de chymus, waarna pancreaslipase triacylglycerolmoleculen splitst in twee vetzuren en één 2-monoacylglycerol. Enterocyten absorberen gemakkelijk de kleine moleculen uit de chymus. Binnenin de enterocyten worden vetzuren en monoacylglyceriden weer omgezet in triacylglyceriden. Vervolgens worden deze lipiden met apolipoproteïne B-48 geassembleerd tot ontluikende chylomicronen. Deze deeltjes worden vervolgens uitgescheiden in de lacteals in een proces dat sterk afhankelijk is van apolipoproteïne B-48. Terwijl ze door de lymfevaten circuleren, omzeilen ontluikende chylomicronen de levercirculatie en worden via het thoracale kanaal afgevoerd naar de bloedbaan.

In de bloedbaan, ontluikende chylomicrondeeltjes interactie met HDL-deeltjes, resulterend in HDL-donatie van apolipoproteïne C-II en apolipoproteïne E aan de ontluikende chylomicron. De chylomicron in dit stadium wordt dan als volwassen beschouwd. Via apolipoproteïne C-II activeren rijpe chylomicronen lipoproteïnelipase (LPL), een enzym op endotheelcellen die de bloedvaten bekleden. LPL katalyseert de hydrolyse van triacylglycerol die uiteindelijk glycerol en vetzuren vrijmaakt uit de chylomicronen. Glycerol en vetzuren kunnen vervolgens worden geabsorbeerd in perifere weefsels, vooral vet en spieren, voor energie en opslag.

De gehydrolyseerde chylomicronen heten nu restanten van chylomicronen. De restanten van chylomicronen blijven in de bloedbaan circuleren totdat ze via apolipoproteïne E een interactie aangaan met receptoren van de restanten van chylomicronen, die voornamelijk in de lever worden aangetroffen. Deze interactie veroorzaakt de endocytose van de chylomicron-resten, die vervolgens in lysosomen worden gehydrolyseerd. Bij lysosomale hydrolyse komen glycerol en vetzuren vrij in de cel, die kunnen worden gebruikt voor energie of worden opgeslagen voor later gebruik.

Endogene route Bewerken

De lever is het centrale platform voor de behandeling van lipiden: hij kan glycerolen en vetten opslaan in zijn cellen, de hepatocyten. Hepatocyten zijn ook in staat om triacylglycerolen te creëren via de novo synthese. Ze produceren ook de gal uit cholesterol. De darmen zijn verantwoordelijk voor het opnemen van cholesterol. Ze brengen het over in de bloedbaan.

In de hepatocyten worden triacylglycerolen en cholesterylesters geassembleerd met apolipoproteïne B-100 om ontluikende VLDL-deeltjes. Ontluikende VLDL-deeltjes komen in de bloedbaan terecht via een proces dat afhankelijk is van apolipoproteïne B-100.

In de bloedbaan, ontluikende VLDL-deeltjes botsen met HDL-deeltjes als resultaat, HDL-deeltjes doneren apolipoproteïne C-II en apolipoproteïne E aan het ontluikende VLDL-deeltje. Eenmaal geladen met apolipoproteïnen C-II en E, wordt het ontluikende VLDL-deeltje als volwassen beschouwd. VLDL-deeltjes circuleren en ontmoeten LPL dat tot expressie wordt gebracht op endotheelcellen. Apolipoproteïne C-II activeert LPL, wat leidt tot hydrolyse van het VLDL-deeltje en het vrijkomen van glycerol en vetzuren. Deze producten kunnen uit het bloed worden opgenomen door perifere weefsels, voornamelijk vetweefsel en spieren. De gehydrolyseerde VLDL-deeltjes worden nu VLDL-restanten of intermediate-density lipoproteïnen (IDL's) genoemd. VLDL-restanten kunnen circuleren en via een interactie tussen apolipoproteïne E en de restreceptor worden geabsorbeerd door de lever, of ze kunnen verder worden gehydrolyseerd door hepatisch lipase.

Hydrolyse door hepatische lipase maakt glycerol en vetzuren vrij, waardoor IDL-resten, low-density lipoproteins (LDL) genaamd, die een relatief hoog cholesterolgehalte bevatten [5] (zie inheemse LDL-structuur bij 37°C op YouTube). LDL circuleert en wordt geabsorbeerd door de lever en perifere cellen. Binding van LDL aan zijn doelweefsel vindt plaats door een interactie tussen de LDL-receptor en apolipoproteïne B-100 op het LDL-deeltje. Absorptie vindt plaats via endocytose en de geïnternaliseerde LDL-deeltjes worden gehydrolyseerd in lysosomen, waarbij lipiden vrijkomen, voornamelijk cholesterol.

Mogelijke rol in zuurstoftransport

Plasmalipoproteïnen kunnen zuurstofgas dragen. [6] Deze eigenschap is te danken aan de kristallijne hydrofobe structuur van lipiden, die een geschikte omgeving voor O . bieden2 oplosbaarheid in vergelijking met een waterig medium. [7]

Rol bij ontstekingen

Ontsteking, een biologische systeemreactie op stimuli zoals de introductie van een pathogeen, speelt een onderliggende rol in tal van systemische biologische functies en pathologieën. Dit is een nuttige reactie van het immuunsysteem wanneer het lichaam wordt blootgesteld aan ziekteverwekkers, zoals bacteriën op plaatsen die schadelijk zullen blijken, maar die ook schadelijke effecten kunnen hebben als ze niet worden gereguleerd. Het is aangetoond dat lipoproteïnen, met name HDL, een belangrijke rol spelen in het ontstekingsproces. [8]

Wanneer het lichaam functioneert onder normale, stabiele fysiologische omstandigheden, is aangetoond dat HDL op verschillende manieren gunstig is. [8] LDL bevat apolipoproteïne B (apoB), waardoor LDL aan verschillende weefsels kan binden, zoals de slagaderwand als de glycocalyx is beschadigd door hoge bloedsuikerspiegels. [8] Indien geoxideerd, kan het LDL vast komen te zitten in de proteoglycanen, waardoor de verwijdering ervan door HDL-cholesterolefflux wordt voorkomen. [8] Normaal functionerend HDL kan het proces van oxidatie van LDL en de daaropvolgende ontstekingsprocessen na oxidatie voorkomen. [8]

Lipopolysaccharide, of LPS, is de belangrijkste pathogene factor op de celwand van Gram-negatieve bacteriën. Gram-positieve bacteriën hebben een vergelijkbare component genaamd Lipoteichoic acid of LTA. HDL heeft het vermogen om LPS en LTA te binden, waardoor HDL-LPS-complexen ontstaan ​​om de schadelijke effecten in het lichaam te neutraliseren en het LPS uit het lichaam te verwijderen. [9] HDL speelt ook een belangrijke rol in de interactie met cellen van het immuunsysteem om de beschikbaarheid van cholesterol te moduleren en de immuunrespons te moduleren. [9]

Onder bepaalde abnormale fysiologische omstandigheden zoals systeeminfectie of sepsis, worden de belangrijkste componenten van HDL veranderd, [9] [10] De samenstelling en hoeveelheid van lipiden en apolipoproteïnen zijn veranderd in vergelijking met normale fysiologische omstandigheden, zoals een verlaging van HDL-cholesterol (HDL-C), fosfolipiden, apoA-I (een belangrijk lipoproteïne in HDL waarvan is aangetoond dat het gunstige ontstekingsremmende eigenschappen heeft), en een toename van serumamyloïde A. [9] [10] Deze veranderde samenstelling van HDL is gewoonlijk aangeduid als acute fase HDL in een acute fase ontstekingsreactie, gedurende welke tijd HDL zijn vermogen kan verliezen om de oxidatie van LDL te remmen. [8] In feite is deze veranderde samenstelling van HDL geassocieerd met verhoogde mortaliteit en slechtere klinische resultaten bij patiënten met sepsis. [9]

Op dichtheid Bewerken

Lipoproteïnen kunnen worden geclassificeerd in vijf hoofdgroepen, gerangschikt van grotere en lagere dichtheid tot kleinere en hogere dichtheid. Lipoproteïnen zijn groter en minder dicht wanneer de vet-eiwitverhouding wordt verhoogd. Ze worden geclassificeerd op basis van elektroforese, ultracentrifugatie en kernmagnetische resonantiespectroscopie via de Vantera Analyzer. [11]

    vervoeren triglyceriden (vet) van de darmen naar de lever, de skeletspieren en het vetweefsel. (VLDL) vervoeren (nieuw gesynthetiseerde) triglyceriden van de lever naar vetweefsel. (IDL) zijn intermediair tussen VLDL en LDL. Ze zijn meestal niet aantoonbaar in het bloed tijdens het vasten. (LDL) vervoeren 3.000 tot 6.000 vetmoleculen (fosfolipiden, cholesterol, triglyceriden, enz.) door het lichaam. LDL-deeltjes worden soms "slechte" lipoproteïnen genoemd omdat concentraties, dosisgerelateerd, correleren met de progressie van atherosclerose.
    • grote drijvende LDL (lb LDL) deeltjes
    • small dense LDL (sd LDL) particles is a lipoprotein particle of a certain phenotype

    For young healthy research subjects,

    70 kg (154 lb), these data represent averages across individuals studied, percentages represent % dry weight:

    Density (g/mL) Klas Diameter (nm) % protein % cholesterol & cholesterol ester % phospholipid % triacylglycerol
    >1.063 HDL 5–15 33 30 29 4-8
    1.019–1.063 LDL 18–28 25 46-50 21-22 8-10
    1.006–1.019 IDL 25–50 18 29 22 31
    0.95–1.006 VLDL 30–80 10 22 18 50
    <0.95 Chylomicrons 75-1200 1-2 8 7 83-84

    [12] [13] However, these data are not necessarily reliable for any one individual or for the general clinical population.

    Alpha and beta Edit

    It is also possible to classify lipoproteins as "alpha" and "beta", according to the classification of proteins in serum protein electrophoresis. This terminology is sometimes used in describing lipid disorders such as abetalipoproteinemia.

    Subdivisions Edit

    Lipoproteins, such as LDL and HDL, can be further subdivided into subspecies isolated through a variety of methods. [14] [15] These are subdivided by density or by the protein contents/ proteins they carry. [14] While the research is currently ongoing, researchers are learning that different subspecies contain different apolipoproteins, proteins, and lipid contents between species which have different physiological roles. [14] For example, within the HDL lipoprotein subspecies, a large number of proteins are involved in general lipid metabolism. [14] However, it is being elucidated that HDL subspecies also contain proteins involved in the following functions: homeostasis, fibrinogen, clotting cascade, inflammatory and immune responses, including the complement system, proteolysis inhibitors, acute-phase response proteins, and the LPS-binding protein, heme and iron metabolism, platelet regulation, vitamin binding and general transport. [14]

    Atherosclerosis is the leading cause of coronary artery disease. [16] And, ischaemic heart disease is the leading cause of mortality in the world. [17] Many studies have examined possible correlations between the incidence of the disease and plasma lipoprotein particle concentrations in the blood. Hypotheses exist for possible causations but none have been proven to date. [18] [19] [20] [21] [22] [23] [24] These studies have shown correlation (and correlation does not imply causation [25] ) between atherosclerosis and concentrations of particles. Studies specifically targeting different phenotypes are needed to determine if the amount of particles are a reaction to diet composition. [26] [27] Citizen scientists are attempting to do that. [28]


    2. Differences between CD spectroscopy of soluble and membrane proteins

    2.1 Effects of fold characteristics of membrane proteins on spectral properties

    figuur 1 Circular dichroism spectra typical of membrane proteins composed of different secondary structural types: predominantly antiparallel alpha-helical bundle (red: a sodium channel pore 48 ) predominantly beta-barrel (blue: BTUB outer membrane cobalamin transporter 23 ), mixed helical, beta sheet and unordered structure (green: WZA translocon for capsular polysaccharides 23 ). The CD spectra correspond to PCDDB 47 IDs CD0004012000, CD0000102000, CD0000128000, respectively. Inset are the crystal structures (PDB IDs 4F4L, 1NQE, and 2J58, respectively) of these proteins depicted in the same colour scheme.

    2.2 Effects of environmental and physical characteristics of membrane proteins on spectral properties

    The dielectric constant (∼1–2) of the hydrophobic core of a detergent micelle or phospholipid bilayer in which a membrane protein is embedded is considerably lower than that of water (∼80). This can cause both bathochromic and hypsochromic shifts in the CD spectrum of proteins measured in these environments compared to the spectra of proteins comprised of similar secondary structures but present in aqueous solution. 19,20 The extent and nature of the shift depends on which electronic transition in the peptide is examined, and on the relative location of the peptide bond with respect to the membrane environment. The direction and magnitudes of the shifts are ultimately related to the changes in the energy gap between the ground and excited states of the transitions, and the peak positions can vary substantially between the same type of secondary structure in aqueous solution and in membranes. 21 As the n → π* and π → π* transitions are differentially affected (Fig. 2), the wavelength dependence on solvent dielectric is non-linear and hence cannot be corrected simply by shifting the entire spectrum. Such shifts in peak positions can have significant effects on secondary structure analyses, and tend to produce inaccurate results when using standard deconvolution methods with the commonly-used reference datasets derived from soluble proteins. 21

    Figuur 2 Demonstration of spectral shifts observed for each of the different electronic transitions in membrane protein spectra relative to those in soluble protein spectra. Membrane proteins (black spectra) and soluble proteins (grey spectra) were selected to have matching secondary structures in each case. 21 Left: Predominantly helical proteins. Right: Predominantly beta sheet proteins. In both examples the arrows indicate the peak positions (in black and grey, respectively) for the membrane and soluble proteins. It is notable that not all of the peaks shift in the same direction, nor to the same extent.
    Fig. 3 Diagram indicating the nature of the phenomenon of light scattering. l 0 is the light incident onto the scattering sample (red circles represent membrane particles). l t is the transmitted light that impinges on the detector and is used to measure the light absorbed by the sample. l s is light scattered in a direction that does not intersect with the detector, and contributes to the additional “apparent” (but not actual) absorbed light. θ is the acceptance angle of the detector and describes the angle of the scattered light that impinges on the detector.
    Afb. 4 Light scattering effects in CD spectra: 14,15 effects of changing the detector acceptance angle ( θ ). Left: Sample (bacteriorhodopsin in octyl glucoside micelles) that does not exhibit scattering, measured at two different values of θ (2 degrees: dashed line and 90 degrees: solid line). It can be seen that the spectra are essentially identical. Right: Sample (bacteriorhodopsin in purple membranes) that exhibits scattering (2 degrees: dashed line and 90 degrees: solid line). In this case the spectra are very different, both in magnitudes and peak positions of the wavelength maxima/minima.

    The simplest methods involve reducing the size of the particles so they are much smaller (∼1/10) than the wavelengths of the UV light used in the investigation. 14 Most detergent micelles are too small to exhibit substantial scattering in the far UV region of the spectrum. However, there may be some concern about the conformation of a protein in a micellar environment being different from that in a membrane due to the packing constraints imposed by the relative size, shape and charge of the detergent head groups and the length and composition of the hydrophobic tail groups. 25 Hence whilst the dimensions of micelles may be ideal for eliminating scattering, their physical characteristics such as their geometry may have deleterious effect on the protein structure. Furthermore, the functions of many types of membrane proteins ( e.g. ion channels) cannot be assessed in micelles so there is no way to ensure their structure is not perturbed.

    Small unilamellar vesicles (SUVs) 14,15,26 (∼25 nm diameter) also tend to produce little scattering in the far UV region, and provide another solution. Such samples can be produced by mechanical means such as sonication or extrusion, but in very small vesicles the protein structure may be distorted by the process of producing the vesicles or by the curvature of the membranes. Alternatively the protein can be examined in bicelles, or nanodiscs, which can also have small dimensions relative to the wavelength of light used for CD studies. Again, however, there may be issues associated with protein integrity in such environments, and because the intra- and extra-cellular surfaces are not in separate compartments, some proteins such as channels also cannot be functionally assayed in these types of samples.

    Alternatively, it has been suggested that scattering effects may not preclude all measurements in large lipid unilamellar vesicles (LUVs), a conclusion largely based on comparisons of a soluble protein in the presence and absence of lipid vesicles. 27 However, in the test samples, 27 the scattering particles (LUVs) were not themselves chiral, nor were the chiral objects (proteins) scatterers, meaning that the scattering would be non-chiral, and would naturally not influence the shape of the CD spectrum. 15 Hence this may not have been an entirely suitable test for a chiral membrane protein in a scattering lipid vesicle. Nevertheless, their conclusions 27 that protein CD spectra obtained in the presence of LUVs could be used if the data were limited to wavelengths above 200 (or 215 nm, depending on the size of the LUVs) may provide another option for avoiding the effects of light scattering. However, it is noteworthy that virtually all secondary structure analysis algorithms require the availability of data down to at least 190 nm (due to the number of eigenvectors of information present) 28,29 so quantitative analyses in LUVs would not be accurate, but may be useful for the qualitative examination of large differences in more native-like environments.

    A simple physical solution to the scattering problem is to locate the sample as close to the instrument detector as possible so that the light scattered at relatively large angles can be captured, eliminating the apparent effect on the spectrum. The detector acceptance angle ( θ ) geometry is defined in Fig. 3. Different commercial CD instruments have different default θ angles, but most can be modified to enable large values of θ by moving the sample (or detector) so that the sample cell is adjacent to the detector face. Most SRCD beamlines have this type of geometry as their default. The effectiveness of this procedure depends on the geometry of the scattering object, with empty and filled spheres, filaments, and discs producing very different 3-dimensional scattering profiles. However for “empty spheres” such as lipid vesicles, the scattering is generally within 90 degrees of the forward direction, 14 an angle that can usually be achieved by the appropriate positioning of the cell and detector.

    A practical consideration issue when moving the detector to obviate the scattering measured from the sample is the sample cell geometry. All of the scattered light from a particular angle θ must reach the detector and not be subtended by the side edges of the sample cell. This thus requires the use of circular rather than rectangular cells, as the sides of the latter would intersect some of the scattered light in the forward directions.

    Afb. 5 Diagram indicating the nature of the phenomenon of absorption flattening. The top panel depicts an isotropic sample, whereas the bottom depicts a membrane sample. The small circles represent proteins, whilst the large circles represent membrane particles. t is the cell pathlength, I 0 is the incident light on each sample. l l is the transmitted light by the isotropic sample, whereas I m is the transmitted light for the membrane sample. l m/ I l = q (the flattening coefficient). In the limit of one protein per membrane, q = 1.
    Fig. 6 Spectra depicting the effects of absorption flattening on the spectra of a membrane protein, bacteriorhodopsin, which has a primarily helical secondary structure. 14 Purple membrane fragments (large particles with low lipid-to-protein ratios, dotted line) where flattening is large, and small unilamellar vesicles (SUVs) (with high lipid-to-protein ratios, solid line) where flattening is negligible. These are compared with the spectrum calculated from the protein crystal structure (dashed line), which would correspond to an “unflattened” spectrum. It clearly matches the SUVs spectrum, but not the spectrum of the membrane fragments.

    The amount of flattening is proportional to the extent of the sample non-uniformity. This would be less problematic if the effect were uniform across the wavelength range of the spectrum, as it could simply be compensated for by a scaling factor. However, this is not the case because absorption (and thus flattening) is a function of the extinction coefficient of the sample at a given wavelength. Hence, the spectrum will not be uniformly flattened at all wavelengths. In an optically active sample the extinction coefficients at a given wavelength are different for left circular polarised light (CPL) and right CPL. As a consequence, the CD peaks are not only depressed with respect to samples at lower concentrations, but further distorted by this differential effect. Differential flattening will be more apparent for CD peaks with higher extinction coefficients (in most cases, this is the electron transition at ∼190 nm). Put simply, the higher the absorbance, the more the flattening, thus not only is the overall spectral magnitude reduced, but also the magnitude of different peaks are reduced by different amounts, thereby distorting the shape of the spectrum. The extent of the flattening will also depend on the relative concentration of the proteins in the particles, with higher concentrations producing more flattening, and also on the geometry of the particles. 31

    An extreme example is the purple membrane containing the membrane protein bacteriorhodopsin, 10,30,31 in which the proteins are close-packed into two-dimensional crystals. Relative to a solution of isolated bacteriorhodopsin molecules, the spectrum of bacteriorhodopsin in purple membranes is not only much smaller, but the more intense peaks at ∼190 and 208 nm are significantly depressed relative to the less intensely absorbing peak at ∼222 nm. When compared with a dispersed sample of the protein in SUVs, or the back-calculated spectrum from the crystal structure, the spectrum of the highly concentrated protein patches is very different 14 (Fig. 6).

    The extent of the flattening ( q ) at any wavelength can be expressed as the ratio of the absorbance (or ellipticity in the case of CD) of the spectrum of the protein in the membrane particle ( A m) divided by absorbance (or ellipticity) of the spectrum of the same protein in a completely dispersed form ( A l).


    2.2.3.2 Solutions/corrections for the phenomenon. Obviously the simplest means of correcting for this phenomenon would be to completely disperse the protein in a form where there was one protein per particle. If the protein can be incorporated into particles (detergent micelles, lipid vesicles, bicelles, amphipols, nanodiscs, or membrane fragments) containing a single protein then the dispersed condition can be met. 30,31 However, that condition is challenging to meet, even for SUVs. It cannot be achieved simply by sonication of larger particles, as decreasing the particle size whilst maintaining the lipid-to-protein ratio will not significantly affect the distribution of absorbing proteins. The complete elimination of flattening in SUVs requires lipid-to-protein molar ratios of around 2000 [see Section 2.3]. However the CD signal from a sample with such a high lipid-to-proteins ratio will generally be compromised by the absorption of the phospholipid carboxyl groups which absorb strongly in the wavelengths of interest. So for membrane proteins there is often a trade-off of concerns for detergent effects versus spectral distortions produced by the particulate nature of lipid membranes.

    2.3 Effects of lipid-to-protein molar ratios

    However, the high light flux of SRCD beamlines [see Section 4.4] (which enables light penetration through relatively opaque samples) can mitigate against these problems by enabling the measurement of SUVs which have lipid-to-protein ratios of 250:1 or even as high as 2000:1. 6


    The SND proteins constitute an alternative targeting route to the endoplasmic reticulum

    In eukaryotes, up to one-third of cellular proteins are targeted to the endoplasmic reticulum, where they undergo folding, processing, sorting and trafficking to subsequent endomembrane compartments. Targeting to the endoplasmic reticulum has been shown to occur co-translationally by the signal recognition particle (SRP) pathway or post-translationally by the mammalian transmembrane recognition complex of 40 kDa (TRC40) and homologous yeast guided entry of tail-anchored proteins (GET) pathways. Despite the range of proteins that can be catered for by these two pathways, many proteins are still known to be independent of both SRP and GET, so there seems to be a critical need for an additional dedicated pathway for endoplasmic reticulum relay. We set out to uncover additional targeting proteins using unbiased high-content screening approaches. To this end, we performed a systematic visual screen using the yeast Saccharomyces cerevisiae, and uncovered three uncharacterized proteins whose loss affected targeting. We suggest that these proteins work together and demonstrate that they function in parallel with SRP and GET to target a broad range of substrates to the endoplasmic reticulum. The three proteins, which we name Snd1, Snd2 and Snd3 (for SRP-independent targeting), can synthetically compensate for the loss of both the SRP and GET pathways, and act as a backup targeting system. This explains why it has previously been difficult to demonstrate complete loss of targeting for some substrates. Our discovery thus puts in place an essential piece of the endoplasmic reticulum targeting puzzle, highlighting how the targeting apparatus of the eukaryotic cell is robust, interlinked and flexible.

    Belangenconflict verklaring

    Ribosome-profiling data are deposited in Gene Expression Omnibus (GEO) under accession number GSE85686. The authors declare no competing financial interests.

    Figuren

    (a) RFP-Gas1 localization is not affected by mutants in SRP or…

    (a) Snd2 and Snd3 form a complex together with the Sec61…

    669 kDa, and a second supercomplex of a higher molecular mass. We postulate that the two Sec61/SND complexes may differ in size depending on the presence of additional auxiliary components. For gel source data see Supplementary Figure 1. (b) Loss of each SND protein affects the localization of the others Fluorescent micrographs showing that Snd2 is mislocalized upon deletion of SND3 and Snd3 is mislocalized upon deletion of SND1, suggesting a functional dependence between the three proteins. Scale bars throughout figure, 5 μm. (c) Growth rates reveal the genetic interactions between the SND genes Heterozygous diploids of Δsnd were sporulated and tetrad-dissected to retrieve haploids. Tetrads obtained demonstrate an epistatic interaction between SND1 en SND2 mutants, and a synthetic sick interaction between SND3 en de SND1/2 mutanten. Als SND3 is more than an order of magnitude more abundant than SND1/2, it is possible that this interaction is due to an independent cellular function. (d) RFP-Gas1 localization is comparable between SND single and double mutants Fluorescent micrographs of RFP-Gas1 in SND single and double mutants show that they are epistatic to each other in terms of their effect on targeting. (e) Quantification of RFP-Gas1 mis-localization in SND double mutants Quantification of the RFP-Gas1 mislocalization phenotype in SND single and double mutants (Extended Data Fig. 2d) reveals a buffering epistatic interaction between SND genes (100 cells were counted per strain).

    Extended Data Figure 3. Substrate affinity to…

    Extended Data Figure 3. Substrate affinity to a targeting pathway depends on the position of…


    Biochemistry II Chapter 9 Lipids Practice Questions/MC

    I. They protect the contents of the cell from chaotropic agents such as urea.
    II. They are easily dissociated from the membrane by changes in pH or high salt concentration.
    III. They are held tightly in place by hydrophobic effects between the membrane and hydrophobic amino acids.

    I. fatty acids
    II. triacylglycerols
    III. glycerophospholipids
    NS. sphingomyelins

    I. contain a glycerol core with a phosphocholine headgroup.
    II. contain a modified sphingosine.
    III. often function as receptor components of membranes.
    NS. function as a precursor to sterols.

    I. is often used to direct proteins to the lysosome for incorporation into the lysosome.
    II. is usually not used for small eukaryotic proteins.
    III. of some transmembrane proteins is embedded into the membrane as an anchor.
    NS. is usually cleaved off the completed protein.

    I-cell disease results in psychomotor retardation, skeletal deformities and death. Which of the following is true regarding this disease?

    1. Synthesis occurs with a leading signal peptide
    2. The SRP-ribosome complex binds the SRP receptor-translocon complex
    3. The signal peptide binds the SRP and GDP is replaced with GTP
    4. GTP hydrolysis results in dissociation of SRP and SR
    5. SRP changes in conformation arresting peptide growth
    6. The nascent protein begins to fold and post-translational modification is initiated
    7. Signal peptidase cleaves the protein from the signal peptide

    I. Glycogen has greater polarity than fatty acids.
    II. Fatty acids predominate in an anhydrous form
    III. Fatty acids are less oxidized than carbohydrates.
    NS. Triglycerides have a higher average molecular mass.


    Bekijk de video: Пейте дети Протеин! Для ТЕХ КТО ЖРЕТ ПРОТЕИНИ (November 2021).