Informatie

6.15C: Soorten desinfectiemiddelen - Biologie


Er zijn meerdere soorten desinfectiemiddelen, inclusief maar niet beperkt tot luchtdesinfectiemiddelen, alcoholen en oxidatiemiddelen.

LEERDOELEN

Maak een lijst van de beschikbare soorten desinfectiemiddelen

Belangrijkste punten

  • Luchtdesinfectiemiddelen zijn doorgaans chemische stoffen die in staat zijn micro-organismen die in de lucht zweven te desinfecteren.
  • Alcoholen, meestal ethanol of isopropanol, worden soms gebruikt als ontsmettingsmiddel, maar vaker als antisepticum.
  • Oxidatiemiddelen werken door het celmembraan van micro-organismen te oxideren, wat resulteert in een verlies van structuur en leidt tot cellysis en dood.

Sleutelbegrippen

  • ontsmettingsmiddelen: Ontsmettingsmiddelen zijn stoffen die op niet-levende voorwerpen worden aangebracht om micro-organismen die op de voorwerpen leven te vernietigen. Desinfectiemiddelen zijn stoffen die op niet-levende voorwerpen worden aangebracht om micro-organismen die op de voorwerpen leven te vernietigen.
  • micro-organismen: Een micro-organisme of microbe is een microscopisch organisme dat ofwel een enkele cel (eencellig), celclusters of meercellige relatief complexe organismen omvat.
  • antiseptisch: Elke stof die de groei en reproductie van micro-organismen remt. Omvat over het algemeen alleen die die op levende objecten worden gebruikt (in tegenstelling tot ontsmettingsmiddelen) en die niet door het lymfestelsel worden getransporteerd om bacteriën in het lichaam te vernietigen (in tegenstelling tot antibiotica).

Soorten desinfectiemiddelen zijn onder meer: ​​luchtdesinfectiemiddelen, alcoholen, aldehyden, oxidatiemiddelen, fenolen, quaternaire ammoniumverbindingen, oppervlakken van zilver en koperlegeringen.

Luchtdesinfectiemiddelen

Luchtdesinfectiemiddelen zijn doorgaans chemische stoffen die in staat zijn micro-organismen die in de lucht zweven te desinfecteren. Vaak wordt aangenomen dat desinfectiemiddelen beperkt zijn tot gebruik op oppervlakken, maar dat is niet het geval. In 1928 ontdekte een onderzoek dat micro-organismen in de lucht konden worden gedood met behulp van nevels van verdund bleekmiddel. Een luchtontsmettingsmiddel moet als aerosol of als damp in een voldoende concentratie in de lucht worden verspreid om het aantal levensvatbare infectieuze micro-organismen aanzienlijk te verminderen.

In de jaren '40 en vroege jaren '50 toonden verdere studies de inactivatie aan van diverse bacteriën, het griepvirus en Penicillium chrysogenum (eerder P. notatum) schimmelschimmel die verschillende glycolen gebruikt, voornamelijk propyleenglycol en triethyleenglycol. In principe zijn deze chemische stoffen ideale luchtontsmettingsmiddelen omdat ze zowel een hoge letaliteit voor micro-organismen als een lage toxiciteit voor zoogdieren hebben.

Hoewel glycolen effectieve luchtdesinfectiemiddelen zijn in gecontroleerde laboratoriumomgevingen, is het moeilijker om ze effectief te gebruiken in echte omgevingen omdat de desinfectie van lucht gevoelig is voor continue actie. Continue actie in reële omgevingen met uitwisseling van buitenlucht bij deur-, HVAC- en raaminterfaces, en in de aanwezigheid van materialen die glycolen adsorberen en verwijderen uit de lucht, stelt technische uitdagingen die niet essentieel zijn voor oppervlaktedesinfectie. De technische uitdagingen die gepaard gaan met het creëren van een voldoende concentratie van de glycoldampen in de lucht zijn tot op heden niet voldoende aangepakt.

Alcoholdesinfectiemiddelen

Alcoholen, meestal ethanol of isopropanol, worden soms gebruikt als ontsmettingsmiddel, maar vaker als antisepticum, met het verschil dat alcohol eerder op levend weefsel wordt gebruikt dan op niet-levende oppervlakken. Deze alcoholen zijn niet corrosief, maar kunnen brandgevaarlijk zijn. Ze hebben ook een beperkte restactiviteit door verdamping, wat resulteert in korte contacttijden tenzij het oppervlak wordt ondergedompeld. Ze hebben ook een beperkte activiteit in aanwezigheid van organisch materiaal.

Alcoholen zijn het meest effectief in combinatie met gezuiverd water om diffusie door het celmembraan te vergemakkelijken; 100% alcohol denatureert typisch alleen externe membraaneiwitten. Een mengsel van 70% ethanol of isopropanol verdund in water is effectief tegen een breed spectrum van bacteriën, hoewel hogere concentraties vaak nodig zijn om natte oppervlakken te desinfecteren. Bovendien zijn mengsels met een hoge concentratie (zoals 80% ethanol + 5% isopropanol) vereist om virussen met lipidenomhulsel (zoals HIV, hepatitis B en hepatitis C) effectief te inactiveren. Alcohol is slechts gedeeltelijk effectief tegen de meeste niet-omhulde virussen (zoals hepatitis A), en is helemaal niet effectief tegen schimmel- en bacteriesporen.

De werkzaamheid van alcohol wordt versterkt in oplossing met het bevochtigingsmiddel dodecaanzuur (kokoszeep). Het synergetische effect van 29,4% ethanol met dodecaanzuur is effectief tegen een breed spectrum van bacteriën, schimmels en virussen. Er wordt verder getest tegen Clostridium difficile (C. Verschil) sporen met hogere concentraties ethanol en dodecaanzuur, waarvan is aangetoond dat het effectief is bij een contacttijd van tien minuten.

Aldehyden, zoals formaldehyde en glutaaraldehyde, hebben een brede microbiocide activiteit en zijn sporocide en fungicide. Ze zijn gedeeltelijk geïnactiveerd door organisch materiaal en hebben een lichte restactiviteit. Sommige bacteriën hebben resistentie ontwikkeld tegen glutaaraldehyde; er is ook gevonden dat glutaaraldehyde astma en andere gezondheidsrisico's kan veroorzaken, vandaar dat ortho-ftalaldehyde glutaaraldehyde vervangt.

Oxiderende desinfectiemiddelen

Oxidatiemiddelen werken door het celmembraan van micro-organismen te oxideren, wat resulteert in een verlies van structuur en leidt tot cellysis en dood. Een groot aantal desinfectiemiddelen werkt op deze manier. Chloor en zuurstof zijn sterke oxidatiemiddelen, dus hun verbindingen spelen hier een grote rol.

Fenolen zijn actieve ingrediënten in sommige huishoudelijke ontsmettingsmiddelen. Ze worden ook aangetroffen in sommige mondspoelingen en in desinfecterende zeep en handwasmiddelen.

Quaternaire ammoniumverbindingen (quats), zoals benzalkoniumchloride, zijn een grote groep verwante verbindingen. Van sommige geconcentreerde formuleringen is aangetoond dat ze effectieve ontsmettingsmiddelen op een laag niveau zijn. Quats vertonen doorgaans geen effectiviteit tegen moeilijk te doden niet-omhulde virussen zoals norovirus, rotavirus of poliovirus.


Door UV-licht toe te passen op gewone desinfectiemiddelen zijn ze veiliger in gebruik, blijkt uit onderzoek

Meer dan 400 gangbare desinfectiemiddelen die momenteel in gebruik zijn, kunnen veiliger worden gemaakt voor mens en milieu en kunnen het COVID-19-virus beter bestrijden met de eenvoudige toepassing van UVC-licht, blijkt uit een nieuwe studie van de Universiteit van Waterloo.

Benzalkoniumchloride (BAK) is het meest voorkomende actieve ingrediënt in veel desinfectiemiddelen die regelmatig worden gebruikt in ziekenhuizen, huishoudens en voedselverwerkende fabrieken om te beschermen tegen een breed scala aan virussen en bacteriën - inclusief alle stammen van SARS-CoV-2, het coronavirus dat veroorzaakt COVID-19 -- maar de toxiciteit ervan betekent dat het niet in hoge concentraties kan worden gebruikt. Het betekent ook dat producten die BAK bevatten schadelijk zijn voor mens en milieu.

Onderzoekers van Waterloo ontdekten dat de toxiciteit van de chemische stof volledig kan worden geneutraliseerd met behulp van ultraviolet licht (UVC) wanneer ze worden getest op gekweekte menselijke hoornvliescellen.

"Onze resultaten laten zien dat een desinfectieprocedure met BAK gevolgd door UVC-straling het schadelijke effect van BAK-residuen op mens en milieu kan minimaliseren", zegt Dr. David McCanna van Waterloo's Department of Optometry & Vision Science. "Een dergelijke procedure heeft ook een groot potentieel om de desinfectie-efficiëntie te maximaliseren door gebruik te maken van twee verschillende antimicrobiële mechanismen.

"Terwijl de pandemie voortduurt, zijn onze bevindingen vooral belangrijk omdat het een andere methode biedt om onze ziekenhuizen, voedsel, huizen en het milieu veiliger te maken."

Hoewel het een belangrijk ingrediënt is voor de werkzaamheid van een ontsmettingsmiddel, is BAK ernstig irriterend voor de menselijke huid en ogen. De hoge toxiciteit van de chemische stof beperkt het vermogen om producten met een hoge concentratie BAK te gebruiken om beter te beschermen tegen schadelijke virussen en bacteriën. Hoge niveaus van BAK-residu zijn ook schadelijk voor het milieu en zijn vooral giftig voor vissen, ongewervelde waterdieren en vogels.

Nadat ze een BAK-oplossing hadden blootgesteld aan kiemdodende ultraviolet-C-lampen, brachten ze de oplossing gedurende vijf minuten aan op gekweekte menselijke hoornvliescellen en analyseerden ze op celmetabolische activiteit en levensvatbaarheid. De BAK-oplossingen werden volledig geneutraliseerd door UVC omdat de oplossingen de gekweekte humane cornea-epitheelcellen niet langer schaden.

"Vanwege de bezorgdheid over de verspreiding van COVID-19 gebruiken mensen meer dan ooit producten met BAK als een actief ingrediënt", zegt Waterloo-alumnus en hoofdauteur Dr. Manlong Xu, die momenteel klinisch onderzoeker is aan de afdeling van de Universiteit van Alberta. oogheelkunde en visuele wetenschappen.

"Voor veel industrieën is er de vraag om de doeltreffendheid van standaard desinfectieprocedures te verbeteren, terwijl ook rekening wordt gehouden met mogelijke negatieve gevolgen voor het milieu."

De studie, Neutralisatie van het oog en huidirriterend benzalkoniumchloride met behulp van UVC-straling, geschreven door Dr. McCanna en Dr. Jacob Sivak en Dr. Xu van Waterloo's Faculteit der Wetenschappen, werd onlangs gepubliceerd in het tijdschrift Cutane en oculaire toxicologie.


Als je moeder zegt dat je je handen moet wassen voor het eten, denkt ze aan alle ziektekiemen die je op je handen kunt hebben als je de wereld om je heen aanraakt. Ziektekiemen zijn overal! Ziektekiemen, of micro-organismen, die ziekte en ziekte veroorzaken, kunnen groeien op vele oppervlakken die fomites worden genoemd. Hier is een goede beschrijving van fomites en hoe ze ziektekiemen herbergen van de American Society for Microbiology:

"Fomites? Wat zijn fomites? Dit is een term voor elk levenloos voorwerp dat ziekteverwekkende organismen kan dragen. Je snijplank, gootsteen, het kleingeld in je zak en zelfs die pen die je steeds in je mond stopt, zijn allemaal fomites. Heel weinig dingen die we tegenkomen in onze dagelijkse activiteiten zijn steriel of vrij van microben, inclusief wij. Bij de geboorte beginnen microben onmiddellijk ons ​​lichaam te koloniseren, zoals ze bijna elk object in de wereld doen. Ze drijven rond totdat ze in contact komen met een oppervlak dat biedt voedsel en beschutting.De kans is groot dat u microben aantreft in en op donkere, vochtige voorwerpen die vaak in contact komen met voedsel, vuil of vegetatie. Badkameroppervlakken, haarborstels, koelkasten, gootstenen en snijplanken bevatten vaak veel microben Maar deurknoppen en muren hebben minder omdat ze voedselarm en droog zijn.

"De meeste microben op ons lichaam en andere oppervlakken zijn onschadelijk, maar sommige zijn pathogeen of ziekteverwekkend. Daarom willen we het aantal microben om ons heen onder controle houden. De kans om geïnfecteerd te raken neemt toe met het aantal microben op omringende objecten. Maar wat kunnen we doen om het aantal microben op oppervlakken om ons heen te beïnvloeden?

"Bij deze activiteit test je een gekozen fomiet op de aanwezigheid van microben en de effecten van een ontsmettingsmiddel door bacteriekolonies in een medium op petriplaten te laten groeien. Een medium bevat voedsel, vitamines en zouten die microben helpen groeien. Meestal doe je dat niet Zie geen bacteriekolonies zoals die zich vormen op petriplaten op alledaagse oppervlakken. Dat komt omdat er zelden zo'n perfecte concentratie van voedingsstoffen op fomites in de natuur is." (ASM, 2001)


Een agarplaat met kolonies van micro-organismen die zijn geïsoleerd uit een diepwaterspons. (Wikipedia-bijdragers, originele afbeeldingsbron uit 2006 van NOAA Ocean Explorer)

Hoe goed werken desinfectiemiddelen om oppervlaktebacteriën te reinigen? In dit experiment gebruik je een snijplank als fomite en test je het gebruik van verschillende soorten desinfectiemiddelen. Door bacteriën van het oppervlak te kweken nadat je het hebt schoongemaakt, kom je erachter hoe goed het desinfectiemiddel werkte. Welke soorten desinfectiemiddelen werken het beste? Overweeg eerst wat achtergrondonderzoek te doen om het te begrijpen hoe de verschillende soorten desinfectiemiddelen tasten microben aan.


Desinfectie en desinfectiemiddelen | Microbiologie

Chemische remmers worden veel gebruikt om de verspreiding van ziekteverwekkende micro-organismen te voorkomen en om de groei van microben te voorkomen die voedselbederf of biologische aantasting van industriële producten zouden veroorzaken. Dergelijke chemicaliën die micro-organismen doden of de groei van micro-organismen voorkomen, worden antimicrobiële middelen genoemd.

Er zijn veel verschillende soorten antimicrobiële middelen die worden gebruikt voor de bestrijding van microbiële groei. Micro-organismen variëren in hun gevoeligheid voor bepaalde antimicrobiële middelen. Over het algemeen zijn groeiende micro-organismen gevoeliger dan slapende stadia, zoals sporen.

Veel antimicrobiële middelen zijn bedoeld om het actieve metabolisme te blokkeren en te voorkomen dat het organisme de macromoleculaire bestanddelen produceert die nodig zijn voor reproductie. Omdat ruststadia metabolisch slapend zijn en zich niet voortplanten, worden ze niet beïnvloed door dergelijke antimicrobiële middelen. Evenzo zijn virussen resistenter dan andere micro-organismen tegen antimicrobiële middelen omdat ze metabolisch inactief zijn buiten de gastheercellen.

Voor de vernietiging van bacteriën worden verschillende fysische en chemische methoden gebruikt. Een aantal termen wordt gebruikt om de vernietiging van bacteriën door verschillende processen te beschrijven.

Een kiemdodend middel werd oorspronkelijk gedefinieerd als een middel dat ziekteverwekkende organismen doodde. Het wordt nu gedefinieerd als een middel, meestal chemisch, dat bacteriën (micro-organismen) doodt, maar niet noodzakelijkerwijs hun sporen.

Een bactericide is een middel dat zowel pathogene als niet-pathogene bacteriën doodt, maar niet noodzakelijkerwijs hun sporen. In de praktijk is de term synoniem met kiemdodend middel.

iii. Antiseptisch (Aseptisch):

Een aandoening waarbij sepsis wordt voorkomen, staat bekend als aseptisch. Sepsis is afgeleid van het Griekse woord dat rotting of rotting betekent. Rotten (verrotting) is te wijten aan microbiële activiteit. Septische toestand wordt meestal gebruikt om de groei van schadelijke microben in levende weefsels van organismen aan te duiden. Aseptische toestand verwijst naar de afwezigheid van microben die infectie veroorzaken. Aseptische toestand kan worden gecreëerd door het doden of bewonen van de groei van micro-organismen.

Aseptische omstandigheden zijn noodzakelijk in ziekenhuizen, waar patiënten met overdraagbare ziekten worden behandeld en in microbiologische laboratoria. Een microbioloog moet zijn kweekmedia, glaswerk en andere apparatuur altijd vrij houden van ongewenste microben.

Een kiemdodend middel kan ook een antisepticum zijn, afhankelijk van de sterkte van de oplossing, de werkingsduur en de aard van het organisme. Een kiemdodend middel in hoge verdunning kan de groei van bacteriën alleen maar remmen in plaats van ze te doden. Ook kan een middel dat in een bepaalde periode doodt, de groei alleen remmen als de blootstellingstijd wordt verkort.

In het eerste geval zou het middel worden geclassificeerd als een kiemdodend middel, in het laatste geval als een antisepticum. Sommige organismen zijn minder resistent tegen giftige stoffen dan andere. Dit betekent dat een stof een kiemdodend middel kan zijn tegen het ene organisme en een antisepticum tegen het andere. Ongetwijfeld spelen ook andere factoren een rol.

Deze term wordt toegepast op elk middel dat filtreerbare vormen, ook wel virussen genoemd, vernietigt of inactiveert. Aangezien virussen van ongeveer dezelfde orde van resistentie tegen chemische agentia zijn als bacteriën, zijn de meeste kiemdodende middelen ook goede viriciden.

Dit kan worden gedefinieerd als een middel, meestal chemisch, dat zowel pathogene als niet-pathogene schimmels vernietigt.

vi. Bacteriostatisch middel::

Deze term werd bedacht door Churchman (1912, 1928), in verband met zijn onderzoek naar kleurstoffen, om een ​​toestand aan te duiden waarin bacteriën niet noodzakelijkerwijs werden gedood, maar alleen verhinderd werden om zich te vermenigvuldigen. Hij merkte op dat kleurstoffen in bepaalde concentraties geen bacteriën doden, maar ze in een toestand van schijndood houden.

Verdere verdunning van het bacterie-kleurstofmengsel resulteerde in groei van de organismen. De kleurstoffen werden bacteriostase genoemd en het fenomeen bacteriostase. Kiemdodende middelen van niet-kleurstof aard, zoals kwik- en zilververbindingen, vertonen hetzelfde fenomeen en worden bacteriostatische verbindingen genoemd.

Dit kan worden gedefinieerd als elk middel dat het aantal bacteriën tot veilige niveaus reduceert, zoals kan worden beoordeeld aan de hand van de eisen van de volksgezondheid. Ontsmettingsmiddelen worden vaak toegepast op levenloze voorwerpen zoals eet- en drinkgerei en apparatuur voor het hanteren van voedsel.

viii. Sterilisatie:

Deze term verwijst naar het proces waarbij alle aanwezige organismen, inclusief sporen, worden vernietigd. De term sterilisatie moet altijd worden gebruikt waar wordt verwezen naar de vernietiging van alle vormen van leven, inclusief schimmels, virussen, sporen, enz.

Een chemisch middel moet de volgende eigenschappen hebben:

1. Microbicide activiteit:

Dit is een voorwaarde. Een chemische stof moet een antimicrobiële eigenschap hebben.

Idealiter zou de chemische verbinding geen enkele verandering ondergaan bij staan ​​of zou de verandering minimaal moeten zijn. In ieder geval mogen deze veranderingen geen nadelig effect hebben op het microbicide vermogen van het chemische middel.

De microbicide chemische stof moet onschadelijk zijn tijdens het hanteren en mag niet giftig zijn voor mensen en andere dieren.

De chemische stof (als het een opgeloste stof is) moet gemakkelijk oplosbaar zijn in water of andere oplosmiddelen om een ​​gemakkelijke toepassing te vergemakkelijken.

5. Toxiciteit voor microben bij normale temperatuur:

De microbicide chemische stof moet effectief zijn onder normale temperatuurbereiken in de omgeving.

Het microbicide preparaat moet een homogeen mengsel zijn van alle chemische ingrediënten, zodat elke ml van het middel alle chemicaliën in de juiste verhouding bevat.

7. Onvermogen om te combineren met andere organische materialen:

Veel chemische middelen hebben affiniteit met eiwitten en combineren daarmee. Het gebruik van dergelijke chemicaliën (in een situatie waarin naast microben ook andere eiwitten aanwezig zijn) zal niet effectief zijn omdat het grootste deel van het microbiële middel niet beschikbaar is om de microben te doden.

8. Capaciteit van penetratie:

Om effectiever te zijn, moet de kiemdodende chemische stof kunnen doordringen en doordringen in het systeem waar het wordt aangebracht.

De chemische stof die voor de microbicide werking wordt gebruikt, moet gemakkelijk in voldoende hoeveelheden beschikbaar zijn.

De chemische stof moet de vieze geur die door de microben wordt geproduceerd, kunnen deodoriseren. De chemische component zelf kan geurloos zijn of een aangename geur hebben.

Het chemische middel moet ook reinigende eigenschappen hebben, samen met een desinfecterend vermogen. Deze dubbele werking zou van een chemische stof een ideaal microbicide middel maken.

Een ideaal chemisch middel mag metalen of andere voorwerpen niet aantasten en mag ook geen vlekken of schade veroorzaken aan stoffen of andere voorwerpen waarmee ze in contact komen.

Voorwaarden die nodig zijn voor microbicide actie:

Het vermogen van een chemische verbinding om een ​​effectief antimicrobieel middel te zijn, hangt af van twee factoren, namelijk het inherente vermogen van de chemische stof om de microben te doden en de omstandigheden van de omgeving waarin een chemische stof op de microben inwerkt. Een chemische stof kan dus alleen bepaalde microben doden en kan nutteloos zijn tegen bepaalde andere microben.

Daarnaast zijn tal van omgevingsfactoren zoals temperatuur, pH van het medium enz. ook van invloed op de microbiële werking. Bij de keuze van een chemisch middel voor microbiële werking moet dan met al deze aspecten rekening worden gehouden. De volgende zijn enkele van de factoren die de werking van een antimicrobiële chemische stof beïnvloeden.

Type micro-organisme:

De keuze van een chemische stof hangt af van welke micro-organismen moeten worden gedood. Niet alle chemicaliën hebben dezelfde werkzaamheid tegen microben zoals schimmels, bacteriën, virussen enz. Daarom moet een chemisch middel worden gekozen op basis van het type microbe dat erbij betrokken is.

Concentratie van microben:

Het type en de concentratie van een chemisch agens varieert met de dichtheid van microben in een bepaalde omgeving.

Aard van het te desinfecteren materiaal:

Het type chemische stof dat wordt geselecteerd voor microbicide activiteit hangt af van het materiaal dat moet worden gesteriliseerd. Een stof als fenyl kan bijvoorbeeld niet worden gebruikt voor toepassing op de huid.

Enkele van de andere factoren die van invloed zijn op de desinfecterende eigenschappen van een chemische stof zijn:

(iv) Aanwezigheid van vreemd materiaal (dat de werking van chemicaliën zou kunnen verstoren).

Classificatie van antimicrobiële chemicaliën:

Microbicide chemicaliën kunnen worden ingedeeld in verschillende groepen op basis van de plaats van actie of het mechanisme van het inactiveren van de microbe.

(i) Middelen die interfereren met membraanfuncties.

(ii) Middelen die eiwitten denatureren en

(iii) Middelen die functionele groepen van eiwitten vernietigen of wijzigen.

In een andere classificatie kunnen microbicide chemicaliën worden ingedeeld in antiseptica en ontsmettingsmiddelen, antimetabolieten en antibiotica.

Antiseptica en ontsmettingsmiddelen zijn algemeen in hun werking en zijn niet specifiek voor enige vorm van microben. Deze omvatten zuren en alkaliën, zepen, halogenen, zware metalen enz.

Antimetabolieten zijn structurele analogen van metabole producten die in microbiële cellen worden aangetroffen.

Deze verbindingen concurreren met de metabolieten en verstoren het microbiële metabolisme. Antibiotica zijn verbindingen die door het ene organisme worden geproduceerd en die giftig zijn voor een ander organisme.

Ontsmettingsmiddelen worden veel gebruikt om micro-organismen te doden of de groei ervan te voorkomen. Deze middelen worden gebruikt voor het verminderen van het aantal micro-organismen op de oppervlakken van levenloze objecten, zoals vloeren en muren. Veel huishoudelijke schoonmaakmiddelen bevatten ontsmettingsmiddelen. Desinfecterende middelen worden ook gebruikt om microbiële populaties in vloeistoffen te beperken, bijvoorbeeld in zwembadwater.

Ontsmettingsmiddelen worden echter niet als veilig beschouwd voor toepassing op menselijke weefsels of voor interne consumptie. Als ze worden gebruikt om micro-organismen te verwijderen uit een consumeerbaar product, zoals drinkwater, moet hun concentratie worden verlaagd voordat het product wordt geconsumeerd.

Ontsmettingsmiddelen dienen uiteraard een hoge kiemdodende werking te hebben. Ze moeten snel een breed scala aan micro-organismen doden, inclusief sporen. Het middel moet chemisch stabiel en effectief zijn in aanwezigheid van organische verbindingen en metalen. Het vermogen om in spleten door te dringen is wenselijk. Het is essentieel dat een desinfectiemiddel de materialen waarop het wordt aangebracht niet vernietigt. Bovendien moet het goedkoop en esthetisch acceptabel zijn.


Desinfectie

Veel desinfectiemiddelen worden alleen of in combinaties (bijvoorbeeld waterstofperoxide en perazijnzuur) gebruikt in de gezondheidszorg. Deze omvatten alcoholen, chloor en chloorverbindingen, formaldehyde, glutaaraldehyde, ortho-ftalaldehyde, waterstofperoxide, jodoforen, perazijnzuur, fenolen en quaternaire ammoniumverbindingen. Commerciële formuleringen op basis van deze chemicaliën worden als unieke producten beschouwd en moeten worden geregistreerd bij EPA of goedgekeurd door de FDA. In de meeste gevallen is een bepaald product ontworpen voor een specifiek doel en moet het op een bepaalde manier worden gebruikt. Daarom moeten gebruikers de etiketten zorgvuldig lezen om ervoor te zorgen dat het juiste product wordt geselecteerd voor het beoogde gebruik en efficiënt wordt toegepast.

Desinfectiemiddelen zijn niet onderling uitwisselbaar en onjuiste concentraties en ongeschikte desinfectiemiddelen kunnen tot hoge kosten leiden. Omdat beroepsziekten onder schoonmaakpersoneel in verband zijn gebracht met het gebruik van verschillende ontsmettingsmiddelen (bijv. formaldehyde, glutaaraldehyde en chloor), moeten voorzorgsmaatregelen (bijv. handschoenen en goede ventilatie) worden gebruikt om blootstelling tot een minimum te beperken 318, 480, 481 . Astma en reactieve luchtwegaandoeningen kunnen optreden bij overgevoelige personen die worden blootgesteld aan chemische stoffen in de lucht, inclusief kiemdodende middelen. Klinisch belangrijke astma kan optreden bij niveaus onder het plafond, gereguleerd door OSHA of aanbevolen door NIOSH. De geprefereerde controlemethode is de verwijdering van de chemische stof (door technische controles of vervanging) of verplaatsing van de werknemer.

Het volgende overzicht van de prestatiekenmerken van elk geeft gebruikers voldoende informatie om voor elk item een ​​geschikt desinfectiemiddel te kiezen en dit op de meest efficiënte manier te gebruiken.


Fysieke methoden van desinfectie

De drie fysieke desinfectiemethoden zijn:

  1. kokend bij 100°C gedurende 15 minuten, wat de vegetatieve bacteriën doodt.
  2. Pasteuriseren bij 63 ° C gedurende 30 minuten of 72 ° C gedurende 15 seconden, waardoor voedselpathogenen worden gedood.
  3. Gebruik makend van niet-ioniserende straling szoals ultraviolet (UV) licht. UV-stralen hebben een lange golflengte en een lage energie. Ze dringen niet goed door en organismen moeten directe blootstelling aan het oppervlak hebben, zoals werkoppervlakken van een biologische veiligheidskast (BSC), om deze vorm van desinfectie te laten werken.

Desinfectietermen kunnen verwarrend zijn

Desinfectie is verwarrend vanwege de vele beschikbare producten en vanwege de meningsverschillen over welke soorten desinfectiemiddelen moeten worden gebruikt.

Desinfectie is verwarrend vanwege de vele beschikbare producten en vanwege de meningsverschillen over welke soorten desinfectiemiddelen moeten worden gebruikt.

Een desinfectiemiddel van hoog niveau is sporendodend en zal ook hydrofiele virussen doden als het op de juiste contacttijd wordt gebruikt binnen de aangegeven gebruiksduur. Bijna iedereen in de hygiëne en tandheelkunde heeft al deze termen gezien, maar hun specifieke betekenis kan verwarrend worden zonder periodieke herziening.

• Soorten desinfectiemiddelen - Een sterilisator* is een middel dat alle micro-organismen kan doden, inclusief bacteriesporen. Een desinfectiemiddel is een middel dat de meeste ziekteverwekkende microben kan doden, maar geen bacteriesporen. Bacteriële sporen zijn de kenmerkende microbe vanwege hun zeer hoge weerstand tegen doden door chemische en fysische middelen.

Een high-level desinfectiemiddel is een chemische oplossing die lage niveaus van bacteriesporen kan doden bij de contacttijd die wordt aanbevolen voor desinfectie op het productetiket (bijvoorbeeld 45-90 minuten). Met een langere contacttijd (bijvoorbeeld 10 uur) wordt het hoogwaardige desinfectiemiddel echter een vloeibaar steriliserend middel dat grote hoeveelheden bacteriesporen kan doden.

Deze dodelijke middelen op hoog niveau werken als een desinfectiemiddel op hoog niveau of als sterilisatiemiddel, afhankelijk van hoe ze worden gebruikt. De contacttijd is de tijd dat het te behandelen voorwerp in direct contact staat met het dodende middel.

Hoogwaardige ontsmettingsmiddelen/vloeibare sterilisatiemiddelen moeten worden gebruikt als immersieproducten en niet voor oppervlaktedesinfectie. Voorbeelden zijn glutaaraldehyden, speciale waterstofperoxide en speciale perazijnzuurproducten. Items die ondergedompeld zijn, moeten worden beperkt tot items die niet door hitte kunnen worden gesteriliseerd (zoals hittegevoelige plastic items).

Een middelmatig ontsmettingsmiddel is een chemisch middel dat geen bacteriesporen doodt, maar tuberculocide is en andere ziekteverwekkende microben doodt. Tuberculocidal geeft aan dat is aangetoond dat het desinfectiemiddel Mycobacterium tuberculosis var. bovis. Deze bacterie is zeer resistent tegen chemische doding en is een kenmerkende microbe voor ontsmettingsmiddelen, net zoals bacteriesporen zijn voor sterilisatiemiddelen.

Enkele voorbeelden van intermediaire desinfectiemiddelen zijn fenolen op waterbasis, fenolen op alcoholbasis, jodoforen, natriumhypochlorieten en andere chloorverbindingen en quaternaire ammoniumverbindingen op alcoholbasis. Deze desinfectiemiddelen worden in de tandheelkunde gebruikt als oppervlaktedesinfectiemiddelen.

De termen op alcoholbasis en op waterbasis betekenen dat ofwel alcohol (ethanol of isopropanol) ofwel water ook aanwezig is met het belangrijkste actieve ingrediënt. Een alcohol-quaternaire ammoniumverbinding kan ethanol en quaternaire ammoniumverbindingen bevatten (soms aangeduid als een "quat"), zoals benzylammoniumchloride of alkyldimethylethylbenzylammoniumchloride.

- Desinfectiemiddelen op laag niveau - Desinfectiemiddelen op laag niveau zijn chemische middelen die niet sporicide of tuberculocide zijn, maar de meeste andere micro-organismen kunnen doden. Desinfectiemiddelen van laag niveau zijn desinfectiemiddelen op ziekenhuisniveau, wat betekent dat is aangetoond dat ze Staphylococcus aureus, Pseudomonas aeruginosa en Salmonella choleraesuis kunnen doden. Deze drie bacteriën zijn niet zo resistent als Mycobacterium of bacteriesporen, maar ze zijn resistenter dan veel andere bacteriën. Desinfectiemiddelen van laag niveau worden niet gebruikt om oppervlakken van patiëntenzorg te desinfecteren, maar worden gebruikt op vloeren, muren en sommige werkbladen. Het meest voorkomende type ontsmettingsmiddel op laag niveau is een alcoholvrije quaternaire ammoniumverbinding.

- Virusdodende activiteit - De meeste virussen worden snel gedood, zelfs met ontsmettingsmiddelen van een laag niveau. Sommige virussen zijn echter resistenter dan andere. Deze resistentie hangt samen met specifieke oppervlakte-eigenschappen van het virus. Virussen die een buitenste lipide (vet) laag op hun oppervlak hebben (een envelop genoemd) worden lipofiele (vetminnende) virussen genoemd. Deze envelop wordt gemakkelijk vernietigd door een verscheidenheid aan chemicaliën en de vernietiging ervan inactiveert het hele virus. Lipofiele virussen - zoals HIV, herpes simplex en influenza - worden dus gemakkelijk gedood door een grote verscheidenheid aan ontsmettingsmiddelen, waaronder ontsmettingsmiddelen van laag niveau.

Virussen die geen lipide-envelop hebben, worden hydrofiele (waterminnende) virussen genoemd. Deze virussen (zoals poliovirus, coxsackievirus) zijn beter bestand tegen chemicaliën omdat ze niet de gevoelige lipidelaag aan de buitenkant hebben.

Ook hebben sommige intermediaire virussen (zoals adenovirussen, rotovirus) geen envelop, maar ze zijn niet zo resistent als de hydrofiele virussen, maar zijn resistenter dan de lipofiele virussen. Ze hebben een "tussenliggende" weerstand.

- Gebruik van desinfectiemiddelen - Enkele termen hebben betrekking op het gebruik van desinfectiemiddelen. Een daarvan is contacttijd, hierboven gedefinieerd. Een andere is de gebruiksduur, gerelateerd aan middelen die geactiveerd moeten worden (zoals alkalische glutaaraldehyden). Gebruiksduur is de tijdsduur dat een product actief blijft nadat het is geactiveerd. Voor alkalische glutaaraldehyden kan deze tijd 14 dagen, 28 dagen of 30 dagen zijn (zoals aangegeven op het productetiket). Voorgereinigd oppervlak of voorreiniging verwijst naar het reinigen van een object of een oppervlak voordat het wordt gedesinfecteerd of gesteriliseerd. Voor een goede oppervlaktedesinfectie wordt het oppervlak dus altijd vooraf gereinigd en vervolgens gedesinfecteerd. Dit heeft ook betrekking op de uitdrukking spray-wipe-spray voor oppervlaktedesinfectie. Je "spuit" op het desinfectiemiddel en "veegt" het oppervlak af (dit is de voorreinigingsstap), en vervolgens "spuit" je het desinfectiemiddel op en laat je het zitten voor de voorgeschreven contacttijd.

De uitdrukking doodt het aids-virus in één minuut die op sommige etiketten van ontsmettingsmiddelen staat, kan verwarrend zijn. Het suggereert dat de contacttijd voor het gebruik van het desinfectiemiddel slechts één minuut is. Hoewel deze tijd misschien voldoende is om HIV te doden, zou het niet lang genoeg zijn om veel andere, meer resistente microben te doden.

Samenvattend is desinfectie verwarrend, simpelweg vanwege de vele beschikbare producten en vanwege de meningsverschillen over welke soorten desinfectiemiddelen moeten worden gebruikt. Hopelijk zullen deze beschrijvingen van desinfectiegerelateerde termen helpen bij het begrijpen van deze belangrijke infectiebeheersingsprocedure.

* Sommige vloeibare sterilisatiemiddelen kunnen prionen, zoals de ziekteverwekker van Creutzfeldt-Jakob, niet vernietigen.

Chris Miller, PhD, is hoogleraar orale microbiologie en executive associate dean aan de Indiana University School of Dentistry.


Ontvang een melding wanneer we nieuws, cursussen of evenementen hebben die voor u interessant zijn.

Door uw e-mailadres in te voeren, stemt u ermee in om berichten van Penn State Extension te ontvangen. Bekijk ons ​​privacybeleid.

Dank u voor uw inzending!

Bacteriële vlekziekte

Lidwoord

Penn State Handboek voor commerciële paddenstoelentelers

Gidsen en publicaties

Pennsylvania Mushroom Integrated Pest Management Handboek

Gidsen en publicaties

Substraatvoorbereiding voor champignons met witte knop

Lidwoord

Nematoden in de commerciële champignonproductie

Lidwoord

Ontsmettingsmiddelen Broom

Wanneer werd broom ontdekt?
In 1825 deed C. Löwig, een Duitse scheikundestudent, onderzoek naar (magnesiumbromiderijk) water uit moerassen. Nadat hij chloor had verwijderd, injecteerde hij chloorgas in de oplossing. Tijdens dit proces ontstond een nieuwe stof broom. Löwig isoleerde broom door extractie met ether en door destillatie. Een Franse chemicus, A. Ballard, ontdekte broom in een extract van zeewier waaruit hij chloor had verwijderd. Ballard ontwikkelde industriële methoden om verschillende zouten uit zeewater te isoleren. The word bromine comes from the Greek word bromos (= smell). It refers to the unpleasant, stinging odor of bromine.

What are the characteristics of bromine?
Bromine has the atomic number 35. Like chlorine, it is a halogen and it easily reacts with other elements. In nature bromine can only be found in compounds. These combinations are called bromides. Bromides are used to obtain pure bromine and to produce bromine products. After fluorine, bromine is the most reactive element. It reacts with many different substances, is very corrosive and destructive on organic material.
Bromine is the only non-metallic element that is liquid at room temperature and standard pressure. It is a red liquid that easily evaporates and smells. Bromine is approximately 3,12 times heavier than water. At temperatures of 58,8 °C it becomes gaseous, whereas at –7,3 °C and lower temperatures it is a solid.

Bromine is a bleach. It is poisonous in fluid form and bromine vapor is destructive for the human skin, eyes and respirational tract. It causes serious burns. A concentration of 1 ppm can cause eye watering and when inhalation of concentrations below 10 ppm occurs, one starts to cough and the respirational tracts are irritated.

Bromine can easily be dissolved in water (35 g per L water), carbon disulfide and other organic solutions. When added to water, bromine forms hypobromous acid. Hyprobromous acid is a weak acid. It partly dissociates to form hydrogen ions and hypobromite ions. The rate of hypobromous acid and hypobromite ions is determined by the pH value of the water. When the pH value is between 6.5 and 9 both hypobromous acid and hypobromite ions can be found in water.

If water contains ammonia nitrogen, bromamines will be formed (NH2Br, NHBr2 and NHBr3). For disinfection bromamines are as effective as hypobromous acid. Changing the pH value influences the amount of mono-, di- and tribromamine that is formed.

Where can bromine be found?
In nature bromine can be found as bromide salts or organic bromine substances. These substances are produced by several sea organisms. Bromine is mostly in soluble salts in seawater, salt lakes and brine.
Seawater contains approximately 65 ppm bromine. The bromine concentration found in brine is much higher, between 2500 and 10,000 ppm.
Bromine is obtained from brine sources in the United States of America and China, from the Dead Sea in Israel and Jordan and from oceanic water from Wales and Japan. Other bromine-rich areas are in France, Italy, Turkmenistan, Ukraine, Azerbeidzjan and Germany. Bromine can also be found in rocks and in the earth's crust.

Figure 1: bromine exists mostly as bromide salts in the sea

How can bromine be produced?
Bromine was first discovered in 1825, but it was not until 1860 that it was produced on a larger scale. In the old days bromine was produced by obtaining a reaction between bromides, pyrolusite and sulphuric acid.

MnO2 + 4 H + + 2 Br - → Mn 2+ + 2 H2O + Br2

Small amounts of bromine can also be obtained by obtaining a reaction between solid sodium bromide (NaBr) and concentrated sulphuric acid (H2DUS4). At first, hydrogen bromine gas (HBr) is formed. The gas is oxidized by sulphuric acid into bromine and sulphur dioxide.

Another method is the electrolysis of bromide solutions. On the positive electrode bromine is formed:

Nowadays bromine is usually created by injection of chlorine into bromide-rich watery solutions with a pH of 3.5.
Seawater is treated with chlorine gas and air. Chlorine gas than oxidizes bromide to bromine. When chlorinated water is added to a watery solution containing bromides, the solution turns brown because of the formation of bromine.

What are the applications of bromine?
The first known application of a bromine-containing product is the color purple. This substance is produced by purple snails and was used by the Romans to paint their clothes purple. This is a very demanding activity and only the richest Romans could buy these clothes.
Nowadays bromine has many applications. In industry and agriculture it is used on a large scale to produce bromine-containing substances. Bromine was used mainly to produce ethyleen dibromide a constituent of lead-containing fuel. Because of its damaging effects on the environment, this product is no longer used. Bromine is applied in brominated flame retardants, in medicines, in photography, in oil production, in paints and in pesticides. In water treatment bromine is used as an alternative for swimming pool disinfection, and for cooling tower disinfection by chlorine.

Disinfection with bromine
In the United States bromine has been used since the 1930's for the disinfection of water.

Can bromine be used for the disinfection of swimming pools?
Bromine substances are disinfectants and can be used as an alternative for chlorine. In swimming pools, bromine is used against the formation and growth of algae, bacteria and odors in swimming water. In the United States, bromine has been used since 1936 to treat swimming water. During World War II, chlorine became scarce and many swimming pools started to use bromine for disinfection instead.
Bromine can be applied in fluid form or in a mixture. When bromine is applied in fluid form, the following equilibrium is established:

This equilibrium strongly depends on the pH value. At the pH value that is usually found in swimming pools, bromine is mainly present as hypobromous acid (HOBr). Bromine has to be used combined with an oxidizing agent (for example chlorine or ozone).

Table 1: influence of the pH on the formation of hypobromous acid.

Hypobromous acid (HOBr) hypobromite ion (OBr-)
% bromine as HOBr pH % bromine as OBr-
100 6,0 0,0
99,4 6,5 0,6
98,0 7,0 2,0
94,0 7,5 6,0
83,0 8,0 17,0
57,0 8,5 43,0

A bromine-containing stick was developed in 1958, because of the risks of using fluid bromine. This stick exists of bromine-chlorine-dimethylhydantoin (Dihalo, DMH). Both chlorine and bromine are attached to a nitrogen atom, which acts as an organic support. Applied to water, DHM is hydrolyzed and forms hypochlorous acid. Some HOCl is formed as well. The hypochlorite ion reacts with bromides to form hypobromous acid. Bromine-chlorine-dimethylhydantoine (BCDMH) is an organic substance after disinfection and oxidation free bromine remains. When BCDMH is dissolved in water, hypobromous acid and hypochlorous acid are released. Those substances react with bromides (Br – ), causing additional hypobromous acid to be produced. This is why bromine can be used both as a disinfectant and as an oxidizing agent. The concentration of BCDMH in water should not reach 200 mg/L or higher, otherwise the equilibrium between the residual disinfectant and the organic matter is disturbed. An advantage of BCDMH is that it is harmless when it is stored. It is easy to apply. Occasionally, the pH value has to be adjusted.

BCDMH is provided as tablets or cartridges. It has a long shelf life and it dissolves very slowly. Another system that can be used is dissolving bromine salt (sodium bromide) in water and activating it by the addition of an oxidator (hypochlorite or ozone). At first, salt is added to the water. Second, the oxidator is added to activate the bromine and hypobromous acid is formed.

During disinfection, hypobromous acid dissociates into bromide ions. These ions can be reactivated.
Bromine reacts with other substances in the water to form bromine-containing substances. These substances are disinfectants and do not give off odors. Bromine does not oxidize ammonia or other nitrogen substances. Hypobromous acid reacts with sunlight.

When the pH value is between 7 and 8,5 dibromoamine is the most common form of bromine. Dibromoamine is almost as effective as free chlorine in killing microorganisms. Dibromoamine is very active and usually dissociates quickly into bromide ions. Because of this, no bromine remains in the water.

Figure 2: different forms of bromine at various pH values and various concentrations of ammonia.

The most important bromide substances used as a biocide are sodium bromide and BCDMH.

Can bromine be used for the disinfection of drinking water?
Free bromine (Br2) is not used in drinking water treatment. It reacts far to quickly with organic substances, and no residue will remain. Bromine gives drinking water a terrible medicine-like taste. Bromine should only be used in emergency cases.

Is bromine used for the disinfection of cooling tower water?

Bromine can be used for the disinfection of cooling tower water. Hypobromous acid is slightly less effective than hypochlorous acid in killing microorganisms. The pH value of the cooling water determines which form of bromine is present. When the pH value is below 8,7, more hypobromous acid (HOBr) is formed. This is more effective than hypobromite ions, which will be more abundant above pH 8,7. This is why bromine is a better disinfectant for alkalic cooling tower water than chlorine. At pH 7,6 and higher, mainly hypochlorite ions are formed. These are less effective than hypochlorous acid. Bromine reacts with ammonia to form bromamines. In contrast to chloramines, bromamines are unstable and will dissociate into hypobromous acid. Most microorganisms in cooling towers can be treated with bromine, as long as there is enough bromine present.

Figure 3: dissociation of hypobromous acid and hypochlorous acid at various pH values

What are the advantages and disadvantages of bromine use?

Voordelen:
Bromine dissolves in water three times better than chlorine. No dangerous gasses are required for bromine production. Bromine's activity in water is short, because it does not bind strongly. The advantage is that the residual concentration is low and no separate substances are required to remove bromine.

nadelen

Bromine is very reactive. To maintain an adequate disinfection, the amount of bromine that is added must be high. Bromine aggressively reacts with metals and it is a corrosive material.
Security measures should be taken when bromine is transported, stored or used.

What is the efficiency of bromine?
The bromamines which are formed when bromine is added to ammonia-rich water are as effective as free chlorine in killing pathogenic microorganisms.

What are the health effects of bromine use?

Bromine concentrations around 0.5 mg/L in swimming pools cause eye and mucous membrane irritation and can lead to odor nuisance.
In nature bromine is found in inorganic substances. During the twentieth century, humans have produced organic bromine for several applications. Organic bromine is not a natural substance and causes severe damage to the environment. Humans can obtain organic bromine through the skin, through food uptake and through inhalation. It is widely used as a spray to kill insects and other unwanted pests. Organic bromine is dangerous for humans and animals. It effects the thyroid gland, genetic material and nerve system.

What are the environmental effects of bromine use?
Bromine is used as a disinfectant, because it is harmful for microorganisms. When organic bromine enters surface waters, it has negative effects on the health of water fleas, fishes, lobsters and algae.

When bromine is used to disinfect water, bromamines and hypobromous acid react with organic matter in the water to form brominated disinfection byproducts. These can be harmful to human health.

What is the legislation for the use of bromine?

EU
In France bromine is used to disinfect swimming pools. The French standard for bromine in swimming pools is 0,7 mg/L. Concentrations of 0,5 mg/L lead to irritations on mucous membranes, eyes and odor nuisance.

When cooling tower water is tapped from a river or lake, and must be discharged into the same water body after it has been used, it must meet certain discharge demands. Aditionally, the water temperature may not be too high, because warm water has a low oxygen content, which promotes algal growth. This can cause fish mortality and a decrease in water biodiversity.

Verenigde Staten

Discharge demands for cooling tower water in the USA are mentioned in the Clean Water Act (CWA) and are established by the Environmental Protection Agency (EPA).


Antimicrobial Testing Methods & Procedures Developed by EPA's Microbiology Laboratory

We develop antimicrobial testing methods and standard operating procedures to measure the effectiveness of hard surface disinfectants against:

  • Staphylococcus aureus.
  • Pseudomonas aeruginosa.
  • Salmonella choleraesuis.
  • Mycobacterium bovis (BCG).
  • Clostridium difficile.
  • Viruses.
  • Biofilm.

Methods are available for the following types of antimicrobial formulations:

Our standard operating procedures are strict interpretations of AOAC International Exit and ASTM International Exit standard methods

For questions about the methods, procedures, and guidance below, please contact the OPP Microbiology Laboratory directly.


(Any of The Materials Highlighted in Blue are Clickable Links for Purchasing)

Cotton Balls from an unopened package

Q-Tips from an unopened package

Large plastic Cutting Board

Slice of lunch meat (Ham, turkey, bologna, etc.)

7 Small cups for holding disinfectant solutions

5 different disinfectant solutions (antibacterial soap, diluted bleach, rubbing alcohol, Lysol, Pine-Sol, etc.)

1. Using the permanent marker, divide the cutting board into six sections, numbering each section #1-6 like this:

2. Put your gloves on and wipe the piece of lunch meat evenly all over the entire cutting board. Wipe as evenly as you can and then leave it out overnight.

3. The next day you will clean each section of the cutting board with a different disinfectant and test the results by growing the bacteria with you Nutrient Agar Kit

4. Prepare your disinfectant solutions by numbering six small cups #1-6 using your permanent marker. Each numbered cup will match one section of your cutting board.

5. Fill each cup with a different disinfectant and make sure you write down which cup number corresponds to which disinfectant solution. Fill the first cup with water as a negative control solution.

6. In your lab notebook, make a data table like the one below to record your results in.

Nummer Type of Disinfectant Number of Colonies Other Observations
1 Water (control)
2
3
4
5
6

7. Using the forceps, grab a cotton ball from the unopened package. Dip it into one of the solutions and rub it on the surface of the cutting board with the corresponding number to the cup of solution you dipped the cotton ball in.

8. After each application, throw the cotton ball away and dip the forceps into an extra cup filled with rubbing alcohol to sterilize the forceps.

9. Repeat steps 7 and 8 until you have applied a different disinfectant to to each square of the cutting board. Allow the board to dry completely.

10. After all sections of the cutting board are dry, you are ready to use your Nutrient Agar Kit to grow bacteria. Prepare the agar plates by numbering them 1-6 to correspond to the sections of the cutting board.

11. Use the forceps to grab a clean Q-Tip from the unopened package and swipe one end across one section of the cutting board using a circular motion. Be sure the end of the Q-Tip does not touch anything else.

12. Using your free hand, open the lid of the agar plate that corresponds to the section of cutting board you swiped with the Q-Tip. Run the end of the Q-Tip across the agar plate in a zig-zag motion. Immediately replace the lid of the agar plate and use some tape to secure it. Make sure during this process you don't set the lid down and get it contaminated before placing it back on the agar plate.

13. Repeat steps 11 and 12 until you have swabbed each section of the cutting board and applied it to an agar plate.

14. Leave the agar plates on a cookie sheet in a warm place for 1-2 days, until you can visually see bacteria colonies.

15. Count the number of colonies on each agar plate and write down the number in your data table in your lab notebook.

16. Take a picture of each plate so you can have an actual picture to show the colonies on each plate.

17. Graph your results and compare the different disinfectants. Which worked best? Which performed the poorest?