Informatie

Mitochondriale genetische code


We weten dat de genetische code universeel is. Mijn vraag is waarom de mitochondriale genetische code anders is dan de universele genetische code?


Uw uitgangspunt is onjuist, de genetische code is NIET universeel. Er is een 'standaard' genetische code, die wordt gevonden bij hogere dieren en planten en bij de meeste bacteriën, maar er is een verscheidenheid aan andere genetische codes die worden gevonden in het hoofdgenoom van meer obscure organismen. Deze staan ​​vermeld op: http://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi .

Er is ook geen mitochondriale genetische code, maar een verscheidenheid aan mitochondriale (en plastide) genetische codes. Een kenmerk van genomen met niet-standaard genetische codes is de kleine omvang, zodat het aantal eiwitten dat wordt beïnvloed door een verandering van een gemeenschappelijke genetische voorlopercode klein zou zijn geweest.

In het geval van mitochondriën van zoogdieren zijn er minder tRNA's en deze hebben niet-standaard anticodon-codon-interacties. De rationalisatie van deze genetische codes kan dus het gevolg zijn geweest van druk om de grootte van het genoom te verkleinen.


Lineaire codes en de mitochondriale genetische code

De oorsprong van de genetische code kan zeker worden beschouwd als een van de meest uitdagende problemen in de theorie van de moleculaire evolutie. Zo zijn de bekende varianten van de genetische code en een mogelijke gemeenschappelijke afstamming ervan uitgebreid bestudeerd in de literatuur. Gonzalez et al. (2012) ontwikkelden de theorie van een oorspronkelijke mitochondriale genetische code die bestaat uit vier basecodons. Deze werden tesserae genoemd en er werd aangetoond dat de tesserae-code een aantal opmerkelijke foutdetectiemogelijkheden heeft. In ons artikel zullen we laten zien dat we met behulp van de klassieke coderingstheorie de tessera-code kunnen construeren als een lineaire codering van de standaard genetische code en tegelijkertijd kan deze worden afgeleid uit de code van alle dinucleotiden door de constructie van Plotkin. Het laat zien dat het tessera-model van de mitochondriale code niet alleen een biologische verklaring heeft, maar ook een duidelijke wiskundige structuur heeft. Dit onderstreept de rol die het tessera-model in de evolutie zou kunnen hebben gespeeld.

trefwoorden: Genetische code Lineaire codes Mitochondriale code Plotkinconstructie Tessera.


De genetische code opnieuw kraken

Open een biologieboek en je vindt een standaardicoon van de moleculaire biologie: de tabel met een samenvatting van de standaard genetische code. Dit verwijst naar de reeks regels waarmee de cel de informatie in het DNA "decodeert" en deze "vertaalt" in de aminozuren waaruit eiwitten zijn opgebouwd. Bijvoorbeeld, in vrijwel alle organismen vertelt het codon (3-letter DNA-sequentie) "AGA" de vertaalmachinerie om het aminozuur asparagine toe te voegen. Hoewel er enkele afwijkingen bekend zijn in de genetische code die door verschillende organismen wordt gebruikt, werd eerder dit jaar in onderzoek gepubliceerd Moleculaire biologie en evolutie en in het huidige nummer van Genoombiologie en evolutie suggereert dat we misschien nog maar aan de oppervlakte zijn gekomen over het aantal variaties dat aanwezig is in de genetische codes van alle levende organismen.

In het aprilnummer van Moleculaire biologie en evolutie, publiceerde een groep onderzoekers, waaronder Emmanuel Noutahi, Virginie Calderon, Mathieu Blanchette, Nadia El-Mabrouk en Bernd Franz Lang van de Université de Montreal, Institut de Recherches Cliniques de Montreal en McGill University een analyse van de mitochondriale genomen van 51 groene algen en landplanten (Noutahi et al. 2019). Deze analyse was gebaseerd op een nieuw uitgebreide versie van de bioinformatica-tool CoreTracker, die eerder door deze groep was ontwikkeld (Noutahi et al. 2017). CoreTracker identificeert verschillen tussen een DNA-sequentie en het verwachte aminozuur op basis van de aminozuren die vaak op die positie worden gevonden in nauw verwante soorten. Met behulp van deze tool identificeerden Noutahi en collega's 14 nieuwe codon-hertoewijzingen waarbij het ene aminozuur door een ander werd vervangen, waarvan de overgrote meerderheid werd gevonden in een groep algen die bekend staat als de Sphaeropleales. Deze algen hebben een ongebruikelijke mitochondriale genoomorganisatie die lijkt te liggen tussen de grotere, voorouderlijke genomen en de compacte, afgeleide genomen van sommige van hun verwanten.

Volgens de auteurs wordt het gebied van genetische code-evolutie gevoed door een snelle toename van genomics-gegevens (genomen plus respectievelijke transcriptomen). Hierdoor zijn "vergelijkende/evolutionaire bioinformatica-procedures zoals CoreTracker nu in staat om niet alleen afwijkingen van de genetische code te voorspellen, maar ook om aanwijzingen te geven met betrekking tot het onderliggende mechanisme." In het licht van hun resultaten stelden de onderzoekers voor dat de afwijkingen van de genetische code in de Sphaeropleales-mitochondriën daadwerkelijk hebben bijgedragen aan hun ongewone genoomorganisatie. Op basis van deze theorie werd na de migratie van sommige mitochondriale genen naar het nucleaire genoom tijdens het genoomreductieproces "UCA" (normaal coderend voor het aminozuur serine) opnieuw toegewezen aan een terminatiecodon. Dit zou het onmogelijk hebben gemaakt dat extra mitochondriale genen naar de kern zouden worden overgebracht, wat zou resulteren in een mitochondriaal genoom dat qua grootte gemiddeld was.

Vóór de publicatie van het artikel van Noutahi et al. hadden onderzoekers David Zihala en Marek Elias van de Universiteit van Ostrava ook onafhankelijk het grote aantal veranderingen in de genetische code in de Sphaeropleales ontdekt. Na de puur toevallige ontdekking van nieuwe genetische codes in verschillende protisten door de onderzoeksgroep van Elias, waren Zihala en Elias gemotiveerd om "een systematische screening te beginnen om mogelijke aanvullende gevallen van organismen te vinden met nieuwe genetische codevarianten of eerder gemiste afwijkingen van de standaard genetische code ." Net als Noutahi et al., omvatte hun methode de identificatie van discrepanties tussen DNA-sequenties en verwachte aminozuren op basis van sequenties die aanwezig zijn in verwante genomen, hoewel ze ook een zekere mate van handmatige curatie uitvoerden. De analyse, gepubliceerd in het huidige nummer van Genoombiologie en evolutie (Zihala en Elias 2019), identificeerden nog enkele codon-hertoewijzingen in de Sphaeropleales, vanwege het feit dat ze een bredere steekproef van deze groep omvatten. Anders waren de resultaten van de twee onderzoeken zeer congruent, ondanks de enigszins verschillende methoden die werden gebruikt. Naast de veranderingen in de genetische code, identificeerden Zihala en Elias ook mutaties in een mitochondriale afgiftefactor - een eiwit dat terminatiecodons herkent - die, volgens Elias, "kunnen worden gekoppeld aan het intrigerende vermogen van sommige sphaeroplealean mitochondria om translatie te beëindigen op codons die normaal worden gelezen als coderend voor een aminozuur. We bieden dus de eerste specifieke hypothese voor de moleculaire onderbouwing van dit ongebruikelijke vermogen."

Over het algemeen benadrukken de bevindingen van beide onderzoeken de noodzaak van een dieper bewustzijn van verschillen in genetische code in de levensboom. Anders zou het gebruik van een onjuiste code bij het afleiden van eiwitsequenties uit DNA-sequenties kunnen leiden tot onnauwkeurigheden in voorspelde eiwitsequenties die worden gebruikt voor zowel fylogenetische als moleculair-biologische analyses. Bovendien, volgens Noutahi en collega's, "zijn de twee publicaties succesvol geweest in het voorspellen van specifieke veranderingen in de betekenis van codons door gebruik te maken van openbaar beschikbare gegevens, zonder biochemische experimenten, maar met veel vertrouwen."

Ze merken echter ook op dat beide onderzoeken strikt computationeel van aard zijn en dat "dit type 'papieren biochemie' zijn beperkingen heeft. Alleen evolutionair gevestigde gevallen van codon-evolutie kunnen worden afgeleid (dwz zonder gevallen van initiële of onvolledige stadia). ), en hoewel veranderingen in het tRNA-repertoire, structuur en specificiteit tot op zekere hoogte kunnen worden afgeleid, is biochemische bevestiging van cruciaal belang." Op deze beperking werd ook gewezen door Elias, die opmerkte dat zijn groep van plan is proteomics-methoden te gebruiken om enkele van hun bio-informatische voorspellingen met betrekking tot de verschillende vermoedelijk opnieuw toegewezen codons te verifiëren. "Helaas", vervolgt Elias, "worden over het algemeen niet-standaard genetische codes gevonden in organismen die moeilijk te bestuderen zijn door directe biochemische of genetische benaderingen, dus het blijft een uitdaging om een ​​dieper inzicht te krijgen in de moleculaire mechanismen achter de waargenomen veranderingen in codons. betekenis."

Toekomstig onderzoek zal vrijwel zeker aanvullende, nog niet geïdentificeerde veranderingen in de genetische code in verschillende organismen aan het licht brengen. Elias merkt inderdaad op: "We analyseren ook enkele opwindende nieuwe gevallen van genetische codemodificatie in nucleaire genomen van bepaalde obscure protisten die werden ontdekt door ons onderzoek van openbaar beschikbare sequentiegegevens." Bovendien hebben de auteurs van de Noutahi et al. studie wijst erop dat, gezien "hoe snel dit veld evolueert, vanwege een steeds toenemend aantal rapporten over afwijkingen van de standaard genetische code - met name in eukaryoten en hun organellen." de reis naar het begrijpen van codon-evolutie met al zijn mechanistische implicaties Is net begonnen."


Omgaan met een onconventionele genetische code in mitochondriën: de biogenese en pathogene defecten van de 5-formylcytosine-modificatie in mitochondriaal tRNA Met

Menselijke mitochondriën bevatten hun eigen genoom, dat een onconventionele genetische code gebruikt. Naast het standaard AUG-methioninecodon, herkent het enkele mitochondriale tRNA-methionine (mt-tRNAMet) ook AUA tijdens translatie-initiatie en verlenging. Post-transcriptionele modificaties van tRNA's zijn belangrijk voor structuur, stabiliteit, correcte vouwing en aminoacylering, evenals voor decodering. De unieke 5-formylcytosine (f5C) modificatie van positie 34 in mt-tRNAMet is lang gepostuleerd als cruciaal voor het decoderen van onconventionele methioninecodons en efficiënte mitochondriale translatie. De enzymen die verantwoordelijk zijn voor de vorming van mitochondriaal f5C zijn echter pas recentelijk geïdentificeerd. De eerste stap van de f5C-route bestaat uit methylering van cytosine door NSUN3. Dit wordt gevolgd door verdere oxidatie door ABH1. Hier bespreken we de rol van f5C, de nieuwste doorbraken in ons begrip van de biogenese van deze unieke mitochondriale tRNA-modificatie en de betrokkenheid ervan bij menselijke ziekten.

trefwoorden: mitochondriën translatie 5'formylcytosine 5'methylcytosine NSUN3 RNA modificatie tRNA.

Belangenconflict verklaring

De auteurs verklaren geen belangenverstrengeling.

Figuren

Grafisch overzicht van het tRNA...

Grafisch overzicht van de tRNA-methionine (mt-tRNA Met ) formyleringsroute. NSUN3 methyleert…


Mitochondriale genetische code - Biologie

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = ---M----------------------- -----M---------------------------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

De mitochondriale code van gewervelde dieren (2):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSS**VVVVAAAADDEEGGGG Begint = ------------------------ ---MMMM---------------M------------ Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCAAAAGGGGGTTTTCCCCCCAAAAGGGGTTTTCCCCCCAAAAGGTCAGTCAGTCTCCCCCAAAAGGTCAGTCAGTCTCCCCC =

De gist mitochondriale code (3):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CCWWTTTTPPPPHHQQRRRRIIMMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = ------------------------ --MM--------------------------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCCCAAAGGGGTTTTCCCCCCAAAAGGGGGTTTTCCTCCCCCAAAAGGGGTTTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

De schimmel-, protozoaire en coelenterate mitochondriale code en de mycoplasma/spiroplasma-code (4):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CCWWLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = --MM-------------------------- ---------------M------------ Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGTCAGTCGTCGGTTTTCCCCAAAAGTCAGTCGTCAG3

De ongewervelde mitochondriale code (5):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSSSSVVVVAAAADDEEGGGG Begint = ---M-------------------- MMMM---------------M----------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCAAAAGGGGGTTTTTCCCCCAAAAGGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCAAAAGGGGTTTCAGTCCCCCAG =AG

De Ciliate-, Dasycladacean- en Hexamita-kerncode (6):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYYQQCC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = ------------------------ --M---------------------------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCCAAAAGGGGTTTTCCCCCCAAAAGGGGGTTTTCCCCCCAAAAGGGGTTTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

De mitochondriale code van Echinoderm en platworm (9):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CCWWLLLLPPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG Begint = ------------------- ---M---------------M----------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCAAAAGGGGGTTTTTCCCCCAAAAGGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCC =AG

De Euplotide Nucleaire Code (10):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CCCWLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = ------------------- ---M---------------------------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCAAAAGGGGGTTTTTCCCCCAAAAGGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAA =AG

De bacteriële en plantaardige plastidencode (11):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = ---M----------------------- --MMMM---------------M----------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCAAAGGGGTTTTCCCCCCAAAAGGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAG

De alternatieve gist-kerncode (12):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CC*WLLLSPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = -------------------------- -----M---------------------------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTTTCCCCAAAAGGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

De Ascidische mitochondriale code (13):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSSGGVVVVAAAADDEEGGGG Begint = ---M--------------------- --MM---------------M----------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCCAAAAGGGGTTTTCCCCCCAAAAGGGGGTTTTCCTCCCCCAAAAGGGGTTTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

De alternatieve mitochondriale code voor platwormen (14):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYYY*CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNNKSSSSVVVVAAAADDEEGGGG Begint = ------------------------ --M---------------------------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCCCAAAGGGGTTTTCCCCCCAAAAGGGGTTTTCCTCCCCCAAAAGGGGTTTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Kerncode Blefarisma (15):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY*QCC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = ------------------- ----M---------------------------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTTTCCCCAAAAGGGGGTTTTCCCCCCAAAAGGGGTTTTCCCCCCAAAAGGTCAGTCAGTCTCCCCCAAAAGGTCAGTCAGTCTCCCCC =

Chlorophycean mitochondriale code (16):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY*LCC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = ------------------ ----M---------------------------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTTTCCCCAAAAGGGGGTTTTCCCCCCAAAAGGGGTTTTCCCCCCAAAAGGTCAGTCAGTCTCCCCCAAAAGGTCAGTCAGTCTCCCCC =

Trematode mitochondriale code (21):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNNKSSSSVVVVAAAADDEEGGGG Begint = ------------------------- ---M---------------M----------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCCCAAAAGGGGGTTTTTCCCCCAAAAGGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCCAAAAGGGGTTTCAGTCCCCC =AG

Scenedesmus obliquus mitochondriale code (22):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FFLLSS*SYY*LCC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = ---------------- ------M---------------------------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGGGTTTTCCCCAAAAGTCAGTCAGTCGTTTTCCCCAAAAGTCAGTCAGTTTTCCCCAAAAGTCAGTCG

Thraustochytrium mitochondriale code (23):

Stnd AAs = FFLLSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Deze AAs = FF*LSSSSYY**CC*WLLLLPPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Begint = ---------------- ----M--M---------------M----------- Basis1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCCCAAAAAAAAAAAAAGGGGGGGGGGGGGGGG Basis2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTTTTCCCCAAAAGTCAGTCGGGTTTTCCCCAAAAGTCAGTCGGGTT

*Sommige nummers zijn overgeslagen om deze codes consistent te maken met de genetische codes die door NCBI worden gebruikt.


Vergelijkbare vragen

Biologie eenvoudige snelle controle

Alle volgende zijn producten van cellulaire ademhaling, behalve (1 punt) water. *** zuurstof. energie. kooldioxide. Wat is de definitie van cellulaire ademhaling? (1 punt) het proces van het gebruik van de chemische energie uit waterstof

Biologie

Welke van de volgende uitspraken is waar? Omdat alle cellen cellulaire ademhaling uitvoeren, bevatten ze mitochondriën. Een cel kan niet worden onderverdeeld in kleinere eenheden die de levende staat behouden. Plantencellen bevatten chloroplasten

Wetenschap

welke structuur is gemeenschappelijk voor zowel prokaryotische als eukaryote cellen? A. mitochondriën b. celmembraan c. endoplasmatisch reticulum d. pladtids

Wetenschap

Als het ene konijn een bruine vacht had en het andere een zwarte vacht, welke conclusie kun je dan trekken over de genetische codes van de konijnen? A. De volgorde van basen in de sectie van het DNA die codeert voor de vachtkleur bij het bruine konijn kan niet door mRNA worden gelezen.

Natuurkunde

zowel chloroplasten als mitochondriën lijken op elkaar omdat ze allebei _______ membranen en hun eigen _____ hebben.

Wetenschap

Waar worden organellen zoals mitochondriën en het Golgi-apparaat gevonden?

Biologie

Noem drie kenmerken van mitochondriën en chloroplasten die de endosymbiotische hypothese van eukaryote evolutie ondersteunen?

Biologie

Wat zijn structuren in eukaryote cellen? Selecteer alles wat van toepassing is. mitochondria DNA-kernplasmide

Wetenschap HULP!

2:Wat is de genetische code? A: De volgorde van aminozuren in eiwitten vormt de genetische code. B: De volgorde van aminozuren in mRNA vormt de genetische code. C: De volgorde van stikstofbasen in tRNA vormt de genetische code. D:De

Welke van de volgende waren directe resultaten van het Human Genome Project? A) ontdekking van de genetische code B) creatie van op PCR gebaseerde tests voor veel genetische ziekten C) de ontdekking dat mensen ongeveer 20.000 genen hebben - ver


Organisatie van plantaardig mitochondriaal DNA | Biotechnologie

In dit artikel zullen we het hebben over de organisatie van mitochondriaal DNA van planten.

Het mitochondriale genoom van hogere planten is het grootste en meest complexe onder de eukaryoten. Het mitochondriale genoom van de plant bevat echter niet veel genen. De complexe aard van het mitochondriaal genoom van planten kan te wijten zijn aan de aanwezigheid van veel chloroplast-sequenties in het mtDNA van hogere planten.

Aangezien mitochondriën hun eigen DNA hebben, vindt transcriptie en translatie plaats voor de synthese van een relatief kleine set van polypeptiden die voornamelijk gericht zijn op ATP-productie. Mitochondriën gebruiken een iets andere genetische code. De meeste genen voor mitochondriale eiwitten zijn aanwezig in nucleair DNA, vertaald in cytosol en bijgevolg naar mitochondriën.

Het circulaire mitochondriale DNA in planten heeft een hoge dichtheid van ongeveer 1,705 gmL-1 in cesiumchloride. Dit werkelijke cijfer komt overeen met ongeveer 47% G + C. Er is een aanzienlijk verschil in grootte tussen het mitochondriaal DNA tussen verschillende organismen en varieert van 16 kb bij mensen tot meer dan 2010 kb in meloen.

De mitochondriale grootte in Brassica campestris is 218 kb en bevat een directe herhaling van 2000 kb, terwijl er in Zea mays vijf directe herhalingen en omgekeerde herhalingssequenties aanwezig zijn in 570 kb DNA (Tabel 5.3). De grootte van ribosomaal RNA (26S en 18S) in mitochondriën van planten is groter dan in andere mitochondriën en er is een uniek 5S-rRNA in hogere planten.

De nauw verbonden 18S- en 5S-genen in maïs zijn gescheiden van het gen voor 25S-rRNA. De rRNA-sequentie in mitochondriën van planten heeft verschillende homologieën met rRNA-genen van bacteriën en chloroplasten. Verschillende bewijzen hebben aangetoond dat DNA-sequenties van het ene organel naar het andere organel kunnen gaan. In maïs is aangetoond dat 12 kb chloroplastsequenties in mitochondriaal DNA zijn ingevoegd.

De mitochondriale genen van planten die coderen voor eiwitten voor cytochroom C-oxidase en het apoproteïne van cytochroom b zijn gesequenced. Inzicht in de DNA-sequentie van andere overeenkomstige genen leidde tot de conclusie dat mitochondriën de universele genetische code niet gebruiken en verschillende andere alternatieven gebruiken, bijvoorbeeld in mitochondriën van maïs CGG-codes voor tryptofaan. Dit codon staat echter voor arginine in universele code. Mitochondriale genen van planten lijken een UGA-terminatiecodon te missen.

In mitochondriën van maïs is een gen voor het apoproteïne van cytochroom b 1164 basenparen lang en codeert het voor een eiwit van 42,9 kD, en de aminozuursequentie ervan vertoont bijna vijftig procent homologie met andere overeenkomstige eiwitten in gist. De aanwezigheid van introns in maïsgenen werd niet aangetoond.

De exacte aard van de verwerking van mitochondriaal DNA is niet bekend. Er wordt echter aangenomen dat het uiteinde van 5' niet is afgetopt en dat er geen uitgebreide poly-adenylatie is. Als gevolg daarvan produceren veel planten geen vruchtbaar stuifmeel, planten vertonen mannelijke steriliteit, die wordt gecontroleerd door nucleaire en mitochondriale genen.

Analyse van het maïsgenoom suggereert dat genen die aanwezig zijn in de mitochondriën de cytoplasmatische mannelijke steriliteit bepalen, en het steriliteitsprobleem kan worden teruggedraaid door nucleaire hersteller (Rf) genen. Het is vaak moeilijk om de sequenties te identificeren die verantwoordelijk zijn voor cytoplasmatische mannelijke steriliteit (cms) vanwege de grotere omvang van mitochondriaal DNA.

In Brassica napus zijn er verschillende cms-geassocieerde Open Reading Frame (ORF) geassocieerd met mannelijke steriliteit, bijvoorbeeld orf224/atp6 locus gekoppeld aan mannelijke steriliteit voor cms-geassocieerde mitochondriale genen pro­vide sterk bewijs dat Turf 13-gen verantwoordelijk is voor cms in T -cytoplasma maïs. Cytoplasmatische mannelijke steriliteit is onderzocht in maïs en is onderscheiden in vier algemene typen, zoals N, T, C en S.

Het normale (N) type geeft aanleiding tot functioneel stuifmeel, terwijl T, C en S mannelijk steriel zijn. Het mitochondriale genoom van het mannelijk steriele S-cytoplasma van maïs bevat het hernieuwde DNA-gebied R, dat twee chimere ORF's bevat. Protoplastfusie-experiment is uitgevoerd om het cms-geassocieerde gen van petunia te identificeren. Functies van genen geassocieerd met cytoplasmatische mannelijke steriliteit.


Andachi, Y., Yamao, F., Muto, A., en Osawa, S., Codonherkenningspatronen zoals afgeleid uit sequenties van de complete set van transfer-RNA-soorten inMycoplasma capricolum: Gelijkenis met mitochondriën. J. molec. Biol.209 (1989) 37–54.

Barrell, G., Bankier, A.T., en Drouin, J., Een andere genetische code in menselijke mitochondriën. Natuur282 (1979) 189–194.

Cantatore, P., Roberti, M., Morisco, R., Rainaldi, G., Gadaleta, M.N., en Saccone, C., Een nieuwe genvolgorde in deParacentrotus lividus mitochondriaal genoom. Gen53 (1987) 41–54.

Clark-Walker, G.D., McArthur, C.R., en Sriprakash, K., Locatie van transcriptionele controlesignalen en overdracht-RNA-sequentie inTorulopsis glabrata mitochondriaal DNA. EMBO J.4 (1985) 465–473.

Gray, M.W., en Boer, P.H., Organisatie en expressie van algen (Chlamydomonas reinhardtii) mitochondriaal DNA. Fil. Trans. R. Soc. Londen. B319 (1988) 135–147.

Gray, M.W., en Doolittle, W.F., Is de endosymbiont-hypothese bewezen? microbiologisch. ds.46 (1982) 1–42.

Gray, M.W., Sankoff, D., en Cedergren, R.J., Over de evolutionaire afdaling van organismen en organellen: een wereldwijde fylogenie op basis van een sterk geconserveerde structurele kern in ribosomaal RNA van kleine subeenheden. nucl. Zuren Res.12 (1984) 5837–5852.

Gray, M.W., Cedergren, R., Abel, Y., en Sankoff, D., Over de evolutionaire oorsprong van het mitochondrion van de plant en zijn genoom. Proc. natl Acad. Wetenschap. VS86 (1989) 2267–2271.

Green, A.G., Maréchal, L., Weil, J.H., en Guillemaut, P., APhaseolus vulgaris mitochondriaal tDNA Leu is identiek aan zijn cytoplasmatische tegenhanger. Molec plant. Biol.10 (1987) 13–19.

Himeno, H., Masaki, H., Ohta, T., Kumagai, I., Miura, K.-I., en Watanabe, K., ongebruikelijke genetische codes en een nieuwe genoomstructuur voor tRNA Ser AGY in mitochondriaal DNA van zeester . Gen56 (1987) 219–230.

Izuchi, S.-I., en Sugita, M., Nucleotide-sequentie van een tomaat mitochondriaal tRNA Cys (GCA) gen. Nucleïnezuren Res.17 (1990) 1248.

Jacobs, H.T., Elliott, D.J., Math, V.B., en Farquharson, A., Nucleotidesequentie en genorganisatie van mitochondriaal DNA van zee-egels. J. molec. Biol.202 (1988) 185–217.

Joyce, P. B. en Gray, M.W., Chloroplast-achtige transfer-RNA-genen die tot expressie worden gebracht in mitochondriën van tarwe. Nucleïnezuren Res.17 (1989) 5461–5476.

Köchel, H.G., Lazarus, C.M., Basak, N., en Küntzel, H., Mitochondriale tRNA-genclusters inAspergillus nidulans: organisaties en nucleotidesequentie. Cel23 (1981) 625–633.

Küntzel, H., en Köchel, H.G., evolutie van rRNA en oorsprong van mitochondriën. Natuur293 (1981) 751–755.

Lee, C.C., Timms, K.M., Trotman, C.N.A., en Tate, W.P., Isolatie van een mitochondriale afgiftefactor van ratten: accommodatie van de veranderde genetische code voor beëindiging. J. biol. Chem.262 (1987) 3548–3552.

Maréchal-Drouard, L., en Guillemaut, P., Nucleotide-sequentie van mitochondriaal tRNA Leu 4 van bonen en van zijn cytoplasmatische tegenhanger. Heronderzoek van het gemodificeerde nucleotide aanwezig op positie 12 in mitochondriale en cytoplasmatische tRNA Leu 1-sequenties van bonen. Nucleïnezuren Res.16 (1988) 11812.

Maréchal-Drouard, L., Weil, J.H., en Guillemaut, P., Import van verschillende tRNA's uit het cytoplasma in de mitochondriën in bonenPhaseolus vulgaris. Nucleïnezuren Res.16 (1988) 4777–4788.

Maréchal-Drouard, L., Guillemaut, P., Cosset, A., Arbogast, M., Weber, F., Weil, J., en Dietrich, A., Transfer-RNA's van aardappel (Solanum tuberosum) mitochondriën hebben verschillende genetische oorsprong. Nucleïnezuren Res.18 (1990) 3689–3696.

McCarroll, R., Olsen, G.J., Stahl, Y.D., Woese, C.R., en Sogin, M.L., Nucleotide-sequentie van deDictyostelium discoideum kleine subeenheid ribosomaal ribonucleïnezuur afgeleid uit de gensequentie: evolutionaire implicaties. Biochemie22 (1983) 5858–5868.

Muramatsu, T., Nishikawa, K., Nemoto, F., Kuchino, Y., Nishimura, A., Miyazawa, T., en Yokoyama, S., Codon en aminozuurspecificiteiten van een transfer-RNA worden beide omgezet door een enkele post-transcriptionele modificatie. Natuur336 (1988) 179–181.

Ohama, T., Osawa, S., Watanabe, K., en Jukes, T.H., Evolutie van de mitochondriale genetische code IV. AAA als asparaginecodon in sommige dierlijke mitochondriën. J. molec. Evol.30 (1990) 329–332.

Osawa, S., Collins, D., Ohama, T., Jukes, T.H., en Watanabe, K., Evolutie van de mitochondriale genetische code III. Hertoewijzing van CUN-codons van leucine naar threonine tijdens de evolutie van gist-mitochondriën. J. molec. Evol.30 (1990) 322–328.

Osawa, S., en Jukes, T.H., Evolutie van de genetische code door anticodon-inhoud. Trends Genet.4 (1988) 191–198.

Osawa, S., en Jukes, T.H., Codon-hertoewijzing (codonopname) in evolutie. J. molec. Evol.28 (1989) 271–278.

Osawa, S., Ohama, T., Jukes, T.H., en Watanabe, K., Evolutie van de mitochondriale genetische code I. Oorsprong van AGR-serine en stopcodons in metazoaire mitochondriën. J. molec. Evol.29 (1989) 202–207.

Osawa, S., Ohama, T., Jukes, T.H., Watanabe, K., en Yokoyama, S., Evolutie van de mitochondriale genetische code II. Hertoewijzing van codon AUA van isoleucine naar methionine. J. molec. Evol.29 (1989) 373–380.

Osawa, S., Muto, A., Jukes, T.H., en Ohama, T., Evolutionaire veranderingen in de genetische code. Proc. Roy. Soc. Londen. B241 (1990) 19–28.

Ozeki, H., Ohyama, K., Inokuchi, H., Fukuzawa, H., Kiochi, T., Sano, T., Nakahigashi, K., en Umesono, K., Genetisch systeem van chloroplasten. Cold Spring Harbor Symp. kwantitatief. Biol.52 (1987) 791–804.

Parks, T.D., Dougherty, W.G., Levings, C.S. III, en Timothy, D.H., Identificatie van twee methoinine-transfer-RNA-genen in het mitochondriale genoom van maïs. Planten Fysiol.76 (1984) 1079–1082.

Schön, A., Kannangara, C.G., Gough, S., en Söll, D., Eiwitbiosynthese in organellen vereist misaminoacylatie van tRNA. Natuur331 (1988) 187 ev.

Seilhamer, J.J., en Cummings, D.J., Gewijzigde genetische code inParamecium mitochondriën: mogelijke evolutionaire trends. Med. gen. Genet.187 (1982) 236–239.

Suyama, Y., Tweedimensionale polyacrylamidegelelektroforese-analyse vanTetrahymena mitochondriaal tRNA. Curr. Genet.10 (1986) 411–420.

Wallace, D.C.W., Structuur en evolutie van organelgenomen. microbiologisch. ds.46 (1982) 208–240.

Weber, F., Dietrich, A., Weil, J.-H., en Maréchal-Drouard, L., Een mitochondriaal isoleucine-tRNA van aardappelen wordt gecodeerd door een mitochondriaal gen dat een methionine-anticodon bezit. nucl. Zuren Res.18 (1990) 5027–5030.

Wolstenholme, D.R., Okimoto, R., Macfarlane, J.L., Pont, G.A., Chamberlin, H.M., Garey, J.R., en Okada, N.A., ongebruikelijke kenmerken van mitochondriale genomen van lagere ongewervelden, in: structuur, functie en biogenese van energieoverdrachtsystemen. Eds E. Quagriello, S. Papa, F. Palmieri en C. Saccone. Elsevier, Amsterdam 1990.

Wakasugi, T., Ohme, M., Shinozaki, K., en Sugiura, M., Structuur van tabakschloroplastgenen van tRNA Ile (CAU), tRNA Leu (CAA), tRNA Cys (GCA), tRNA Ser (UGA) en tRNA Thr (GGU): een compilatie van tRNA-genen uit tabakschloroplasten. Molec plant. Biol.7 (1986) 385–392.

Yang, D., Oyaizu, Y., Oyaizu, H., Olsen, G.J., en Woese, C.R., mitochondriale oorsprong. Proc. natl Acad. Wetenschap. VS82 (1985) 4443–4447.


Mitochondriale genetische code - Biologie

Een abonnement op J o VE is vereist om deze inhoud te bekijken. U kunt alleen de eerste 20 seconden zien.

De JoVE-videospeler is compatibel met HTML5 en Adobe Flash. Oudere browsers die HTML5 en de H.264-videocodec niet ondersteunen, gebruiken nog steeds een op Flash gebaseerde videospeler. We raden aan om de nieuwste versie van Flash hier te downloaden, maar we ondersteunen alle versies 10 en hoger.

Mocht dat niet helpen, laat het ons dan weten.

Mitochondriën produceren energierijke ATP-moleculen en zijn de enige organellen in de dierlijke cel met hun eigen genetisch systeem.

Men denkt dat het huidige mitochondrion is geëvolueerd uit een aerobe bacterie, die een wederzijds voordelige of symbiotische associatie vormde met zijn roofdier.

Na verloop van tijd werden veel genen van deze bacterie overgebracht naar het nucleaire DNA van de gastheercel en gingen andere genen verloren, waardoor een klein maar onafhankelijk mitochondriaal DNA achterbleef.

Some cells, like muscle cells, can contain hundreds of mitochondria, while others, like red blood cells, do not contain any. Each mitochondrion can contain up to 10 copies of the mitochondrial DNA.

Mitochondrial DNA is a closed, circular molecule varying in length from 14,000 to 20,000 bps, in animal cells, as compared to millions of base pairs present in nuclear DNA. 

This mitochondrial DNA encodes only a small number of biomolecules: the 16S and 12S rRNAs, up to 25 tRNAs, and 13 respiratory chain proteins. Nuclear DNA codes for the remaining proteins required for mitochondrial function.

Around 93% of the mitochondrial DNA codes for proteins, unlike nuclear DNA, where only about 1 percent are coding regions. This is partially because introns, which are a regular feature of eukaryotic DNA, are absent in mitochondrial DNA.  

Several sequences of the genetic code are translated differently depending upon the type of DNA. For example, the codon UGA codes for tryptophan in mitochondrial DNA, whereas it is a stop codon in nuclear DNA.

Mitochondrial DNA has a faster rate of evolution than that of nuclear DNA due to the mutation rate in mitochondrial DNA being greater than 10 fold higher. 

This is because mitochondrial DNA is not protected by histones like that of nuclear DNA and is exposed to reactive oxygen species generated during mitochondrial reactions. Additionally, it also has less efficient DNA repair machinery.

Transfer of mitochondrial DNA always happens from mother to offspring. This is known as maternal inheritance. 

Maternal inheritance occurs because, after fertilization, the few mitochondria present in sperm are degraded while the many mitochondria in the ovum remain present in the embryo and are passed onto all the cells in the offspring.

6.13: Animal Mitochondrial Genetics

Among all the organelles in an animal cell, only mitochondria have their own independent genomes. Animal mitochondrial DNA is a double-stranded, closed-circular molecule with around 20,000 base pairs. Mitochondrial DNA is unique in that one of its two strands, the heavy, or H, -strand is guanine rich, whereas the complementary strand is cytosine rich and called the light, or L, -strand. Compared to nuclear DNA, mitochondrial DNA has a very low percentage of non-coding regions and is marked by the complete absence of introns. Also, their genes are very closely spaced and some of them even have overlapping regions. D-loop is the most important regulatory non-coding region of mitochondrial DNA, which also contains the origin of the replication for the H-strand. Mitochondrial genetic code differs from nuclear DNA code with respect to a few codons. For example, codon UGA, AUA, and AGA/AGG codes for STOP codon, isoleucine, and arginine, respectively, in nuclear DNA while the same codons codes for tryptophan, methionine and STOP codon, respectively, in animal mitochondrial DNA. 

Replication of nuclear DNA is coordinated with the cell cycle and must be finished before cell division occurs. Another characteristic feature of the mitochondrial genome is its relaxed DNA replication, where unlike nuclear DNA, replication is independent of the cell cycle and can go on in daughter cells even after cell division.

Maternal Inheritance

In mammals, mitochondrial DNA gets inherited only from the mother’s oocyte as the mitochondria present in the sperm are selectively degraded by a ubiquitin-mediated pathway in the zygote.  Mutations in mitochondrial genes can result in diseases such as Leber’s hereditary optic neuropathy or Leigh syndrome therefore,  if the mother carries such mutations, her offspring can inherit these diseases. Recently, new therapies such as mitochondrial replacement can allow the birth of an unaffected child to an affected mother.   The nucleus of the mother’s oocyte is transferred to an enucleated oocyte of a healthy donor with normal mitochondria before fertilization. This technique has led to the birth of the so-called “three-parent baby,” who did not inherit the mother’s mitochondrial disease.


Fungal Genomics

3.2.2 Optional introns in mitochondrial genomes

Mitochondrial genomes in the true fungi are highly variable both in size and organization. Most of this size variation is due to the presence of introns and intron-encoded open reading frames (ORFs) (Wolf and Giudice 1988 Clark-Walker 1992 Gillham 1994 Belcour et al. 1997 Salvo et al. 1998). For example, the Oak Ridge laboratory strains of Neurospora crassa have a 62-kbp mitochondrial genome that contains ten introns which account for about 20 kb of the DNA ( Collins 1993 ), whereas Podospora anserina race A has a mitochondrial genome that is approximately 100 kbp in size, about 60 kbp consists of 36 introns and intron-encoded ORFs ( Cummings et al. 1990). One extreme example is provided by Podospora anserina in which DNA sequence analysis revealed that the cox1 gene alone extends over 24.5 kilobase pairs and contains sixteen introns ( Cummings et al. 1989 ). This is in contrast to the mtDNA of the fission yeast S. pombe in which the entire mitochondrial genome is composed of 19 431 nucleotides and contains only three introns ( Lang 1984 Lang et al. 1985 Lang et al. 1999 ). Furthermore, for both S. cerevisiae en S. pombe it has been demonstrated that introns are dispensable genetic elements (Séraphin et al. 1987 Schäfer et al. 1991 Wolf 1994 ). Comparative studies among the budding yeasts, the fission yeasts, and species of Aspergillus, neurospora and allied genera have demonstrated that at least some of these optional introns are mobile and probably even capable of inter species lateral transfer ( Dujon 1989 Dujon and Belcour 1989 Clark-Walker 1992 Grivell 1995 Wolf 1994 ). Intron insertion occurs mainly in highly conserved sites within mitochondral genes. Even phylogenetically unrelated species from different kingdoms can contain introns in identical regions of homologous genes, thus supporting arguments for horizontal intron transmission ( Wolff et al. 1993 ).

It has been experimentally demonstrated that in Aspergillus japonicus introns can be transmitted among heterokaryon incompatible strains after protoplast fusion ( Hamari et al. 2001 Hamari et al. 2002). In nature, either transient or temporary hyphal anastomosis might allow for heteroplasmons wherein mitochondria from different strains can mix and fuse and introns can mobilize, generating recombinant mtDNAs due to gain or loss of introns ( Hamari et al. 2002). In S. cerevisiae intron mobility can be demonstrated experimentally by crossing compatible strains wherein one parental mtDNA harbors a mobile intron (donor) and the other parent contributes mtDNAs that lack the equivalent intron (recipient) ( Butow and Zinn 1986 Gillham 1994 Wolf 1996 ). A more detailed discussion of fungal mtDNA introns, their biology, RNA components and their encoded ORFs will follow later in this review (see section 4 ).


Bekijk de video: Genetic Engineering Will Change Everything Forever CRISPR (Januari- 2022).